DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and tpx1

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_588430.1 Gene:tpx1 / 2539572 PomBaseID:SPCC576.03c Length:192 Species:Schizosaccharomyces pombe


Alignment Length:195 Identity:114/195 - (58%)
Similarity:150/195 - (76%) Gaps:4/195 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AVRVQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDIN 103
            ::::.:|||||||.|||:.:|:|:||.||:||::.|.|||||||||||||||||||...:|.:.|
pombe     2 SLQIGKPAPDFKGTAVVNGAFEEIKLADYKGKWVFLGFYPLDFTFVCPTEIVAFSEAASKFAERN 66

  Fly   104 TEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDP 168
            .:|:..|.||.:|||.:.|..||.||:|.:..|||:|.:.|:|.||.||::..|::.||.|:|||
pombe    67 AQVILTSTDSEYSHLAFINTPRKEGGLGGINIPLLADPSHKVSRDYGVLIEDAGVAFRGLFLIDP 131

  Fly   169 NGILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPDVEESKKYFSKH 233
            .|:|||.:||||||||||||.|||:.||||||:|||||||||:..|:  ||  |.:..:||||||
pombe   132 KGVLRQITINDLPVGRSVDEALRLLDAFQFVEEHGEVCPANWHKGSD--TI--DTKNPEKYFSKH 192

  Fly   234  233
            pombe   193  192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 112/192 (58%)
PRX_Typ2cys 42..212 CDD:239313 104/169 (62%)
1-cysPrx_C 195..232 CDD:287400 22/36 (61%)
tpx1NP_588430.1 AhpC 1..192 CDD:223527 112/193 (58%)
PRX_Typ2cys 5..176 CDD:239313 104/170 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I3689
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.