DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and prdx-3

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_497892.1 Gene:prdx-3 / 175573 WormBaseID:WBGene00011110 Length:226 Species:Caenorhabditis elegans


Alignment Length:234 Identity:119/234 - (50%)
Similarity:156/234 - (66%) Gaps:16/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SFVARSLIRNVPLMGKAILSQQKQIAARLLHQTAPLAAVRVQQP---APDFKGLAVVDNSFQEVK 63
            |...|:|.|.||           .:|.|.|..:..|.::|...|   .|.|||.||||..|:.:.
 Worm     3 SSAVRALCRTVP-----------TVATRQLSTSRALLSLRPLGPKNTVPAFKGTAVVDGDFKVIS 56

  Fly    64 LEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDINTEVLGVSVDSHFSHLTWCNVDRKNG 128
            .:||:||:||:|||||||||||||||:|:.:|..||..:..||:..|.|||||||.|.|..||:|
 Worm    57 DQDYKGKWLVMFFYPLDFTFVCPTEIIAYGDRANEFRSLGAEVVACSCDSHFSHLAWVNTPRKDG 121

  Fly   129 GVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPNGILRQYSINDLPVGRSVDEVLRLI 193
            |:|.:..|||:|..|||:..:.||..:.|:|.||.|:|||:|.:|..:.|||||||||||.||::
 Worm   122 GLGDMDIPLLADFNKKIADSFGVLDKESGLSYRGLFLIDPSGTVRHTTCNDLPVGRSVDETLRVL 186

  Fly   194 KAFQFVEQHGEVCPANWNPNSNPATIKPDVEESKKYFSK 232
            |||||.::|||||||:|:.:|  .||||.|..||:||:|
 Worm   187 KAFQFSDKHGEVCPADWHEDS--PTIKPGVATSKEYFNK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 109/196 (56%)
PRX_Typ2cys 42..212 CDD:239313 97/172 (56%)
1-cysPrx_C 195..232 CDD:287400 22/36 (61%)
prdx-3NP_497892.1 PRX_Typ2cys 37..206 CDD:239313 96/168 (57%)
AhpC 38..223 CDD:223527 106/186 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4944
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - LDO PTHR42801
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.