DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and Prdx3

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_031478.1 Gene:Prdx3 / 11757 MGIID:88034 Length:257 Species:Mus musculus


Alignment Length:191 Identity:130/191 - (68%)
Similarity:153/191 - (80%) Gaps:2/191 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDINTEV 106
            |.|.||.|||.|||:..|:|:.|:|::|||||||||||||||||||||||||::..||||:|.||
Mouse    66 VTQHAPYFKGTAVVNGEFKELSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEV 130

  Fly   107 LGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPNGI 171
            :.||||||||||.|.|..|||||:|.:...||||:||:||.||.|||:..||:|||.|||||||:
Mouse   131 VAVSVDSHFSHLAWINTPRKNGGLGHMNITLLSDITKQISRDYGVLLESAGIALRGLFIIDPNGV 195

  Fly   172 LRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPDVEESKKYFSK 232
            ::..|:|||||||||:|.|||:|||||||.|||||||||.|.|  .||||....||:||.|
Mouse   196 VKHLSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTPES--PTIKPSPTASKEYFEK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 130/191 (68%)
PRX_Typ2cys 42..212 CDD:239313 119/169 (70%)
1-cysPrx_C 195..232 CDD:287400 25/36 (69%)
Prdx3NP_031478.1 PRX_Typ2cys 66..236 CDD:239313 119/169 (70%)
PTZ00253 70..252 CDD:140280 125/183 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 192 1.000 Domainoid score I3208
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4944
Inparanoid 1 1.050 273 1.000 Inparanoid score I2963
Isobase 1 0.950 - 0 Normalized mean entropy S305
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 1 1.000 - - oto92848
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - LDO PTHR42801
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6659
SonicParanoid 1 1.000 - - X272
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.820

Return to query results.
Submit another query.