DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and Prdx1

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_476455.1 Gene:Prdx1 / 117254 RGDID:620039 Length:199 Species:Rattus norvegicus


Alignment Length:193 Identity:119/193 - (61%)
Similarity:148/193 - (76%) Gaps:3/193 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVQQPAPDFKGLAVV-DNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDINT 104
            ::..|||.||..||: |..|:::.|.||:|||:|.|||||||||||||||:|||:|.:||..:|.
  Rat     7 KIGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNC 71

  Fly   105 EVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPN 169
            :|:|.||||||.||.|.|..:|.||:|.:..||:||..:.|:.||.||...||||.||.||||..
  Rat    72 QVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDK 136

  Fly   170 GILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPDVEESKKYFSK 232
            |||||.:||||||||||||:|||::||||.::|||||||.|.|.|:  ||||||.:||:||||
  Rat   137 GILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSD--TIKPDVNKSKEYFSK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 119/193 (62%)
PRX_Typ2cys 42..212 CDD:239313 105/170 (62%)
1-cysPrx_C 195..232 CDD:287400 24/36 (67%)
Prdx1NP_476455.1 PRX_Typ2cys 8..180 CDD:239313 105/171 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X272
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.