DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and PRDX3

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_006784.1 Gene:PRDX3 / 10935 HGNCID:9354 Length:256 Species:Homo sapiens


Alignment Length:205 Identity:131/205 - (63%)
Similarity:160/205 - (78%) Gaps:2/205 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ARLLHQTAPLAAVRVQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAF 92
            |:|...::...|..|.|.||.|||.|||:..|:::.|:|::||||||||||||||||||||||||
Human    51 AKLFSTSSSCHAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAF 115

  Fly    93 SERIKEFHDINTEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEG 157
            |::..||||:|.||:.||||||||||.|.|..|||||:|.:...|||||||:||.||.|||:..|
Human   116 SDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSG 180

  Fly   158 ISLRGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPD 222
            ::|||.|||||||:::..|:|||||||||:|.|||:||||:||.|||||||||.|:|  .||||.
Human   181 LALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDS--PTIKPS 243

  Fly   223 VEESKKYFSK 232
            ...||:||.|
Human   244 PAASKEYFQK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 128/193 (66%)
PRX_Typ2cys 42..212 CDD:239313 117/169 (69%)
1-cysPrx_C 195..232 CDD:287400 24/36 (67%)
PRDX3NP_006784.1 PRX_Typ2cys 65..236 CDD:239313 117/170 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 192 1.000 Domainoid score I3230
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4944
Inparanoid 1 1.050 275 1.000 Inparanoid score I2982
Isobase 1 0.950 - 0 Normalized mean entropy S305
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 1 1.000 - - oto89279
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - LDO PTHR42801
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6659
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.820

Return to query results.
Submit another query.