DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and PRDX4

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_006397.1 Gene:PRDX4 / 10549 HGNCID:17169 Length:271 Species:Homo sapiens


Alignment Length:207 Identity:122/207 - (58%)
Similarity:152/207 - (73%) Gaps:6/207 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IAARLLHQTAPLAAVRVQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIV 90
            :|...||    |:..::.:|||.::|.||:|..|:|:||.||||||||.|||||||||||||||:
Human    69 VADHSLH----LSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEII 129

  Fly    91 AFSERIKEFHDINTEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDK 155
            ||.:|::||..|||||:..||||.|:||.|.|..|:.||:|.::.|||||||.:||.||.|.|:.
Human   130 AFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLED 194

  Fly   156 EGISLRGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIK 220
            .|.:|||.||||..|||||.::|||||||||||.|||::|||:.::|||||||.|.|.|.  ||.
Human   195 SGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSE--TII 257

  Fly   221 PDVEESKKYFSK 232
            ||.....|||.|
Human   258 PDPAGKLKYFDK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 118/193 (61%)
PRX_Typ2cys 42..212 CDD:239313 108/169 (64%)
1-cysPrx_C 195..232 CDD:287400 20/36 (56%)
PRDX4NP_006397.1 PRX_Typ2cys 81..252 CDD:239313 108/170 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.