DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr-2 and P5CR

DIOPT Version :9

Sequence 1:NP_650632.1 Gene:P5cr-2 / 42106 FlyBaseID:FBgn0038516 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_196984.1 Gene:P5CR / 831332 AraportID:AT5G14800 Length:276 Species:Arabidopsis thaliana


Alignment Length:266 Identity:128/266 - (48%)
Similarity:168/266 - (63%) Gaps:5/266 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIGFLGGGNMAKALAKGFLAAGLAKPNTLIASVHPADKLSLQS-FQSLGVETVIKNAPVVQQSDV 69
            |:||:|.|.||:::|:|.:|:|:..||.:..:||  ..|:.:. |:|.||.....:..||::|||
plant    12 KVGFIGAGKMAESIARGVVASGVLPPNRICTAVH--SNLNRRDVFESFGVNVFSTSEEVVKESDV 74

  Fly    70 VFVSVKPQVVPSVLSEIQ-PLSSGKLFLSVAMGITLSTIESSLSPQARVIRVMPNLPAVVCSGCS 133
            |..|||||||...::|:: .||..|:.:|||.||.|:.:: ..|.|.|.||||||.||.|....|
plant    75 VIFSVKPQVVKKAVTELKSKLSKNKILVSVAAGIKLNDLQ-EWSGQDRFIRVMPNTPAAVGEAAS 138

  Fly   134 VFVRGSKATDADADITQKLLQSVGTCEPVDESQLDVVTALSGSGPAYVFVMIEALADGAVHMGMP 198
            |...|:.||:.|..|...|..:||.....||...|.||.||||||||:|:.|||||||.|..|:|
plant   139 VMSLGTGATEEDGAIVAMLFGAVGKILKADEKMFDAVTGLSGSGPAYIFLAIEALADGGVAAGLP 203

  Fly   199 RDLAYRLASQTVLGAGHMVRDSGMHPGQLKDGVTSPAGSTAAALRQLELSGFRAAVSGAVEQATL 263
            |:||..|||||||||..||..:|.|||.|||.||||.|:|.|.:.:||...|||.:..||..|..
plant   204 RELALSLASQTVLGAATMVSKTGKHPGVLKDDVTSPGGTTIAGVHELEKGSFRATLMNAVVAAAK 268

  Fly   264 RCRQIS 269
            |.|::|
plant   269 RSRELS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5cr-2NP_650632.1 PLN02688 6..270 CDD:178291 128/266 (48%)
F420_oxidored 8..101 CDD:281759 39/94 (41%)
P5CR_dimer 163..267 CDD:291418 61/103 (59%)
P5CRNP_196984.1 PLN02688 11..276 CDD:178291 128/266 (48%)
F420_oxidored 14..107 CDD:281759 39/94 (41%)
P5CR_dimer 168..272 CDD:291418 61/103 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3292
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56130
Inparanoid 1 1.050 223 1.000 Inparanoid score I1181
OMA 1 1.010 - - QHG60612
OrthoDB 1 1.010 - - D952695at2759
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 1 1.000 - - oto3570
orthoMCL 1 0.900 - - OOG6_100382
Panther 1 1.100 - - O PTHR11645
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X667
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.880

Return to query results.
Submit another query.