DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr-2 and Noxred1

DIOPT Version :9

Sequence 1:NP_650632.1 Gene:P5cr-2 / 42106 FlyBaseID:FBgn0038516 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_082020.1 Gene:Noxred1 / 71275 MGIID:1918525 Length:366 Species:Mus musculus


Alignment Length:116 Identity:33/116 - (28%)
Similarity:51/116 - (43%) Gaps:21/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IGFLGGGNMAKALAKGFLAAGLAKPNTLIASVH-PADKL--------SLQSFQSLGVETVIKNAP 62
            :|.:|.|::.|.|.           |.|:.:|. ||:.|        ||...:.|||..|..||.
Mouse    81 VGIIGCGHLGKQLT-----------NVLLKTVPIPAENLQISTRRPESLGELRKLGVRCVYDNAA 134

  Fly    63 VVQQSDVVFVSVKPQVVPSVLSEIQ-PLSSGKLFLSVAMGITLSTIESSLS 112
            |...:.|:|:...|..:|::..||| .|:......|....|.|..::|.|:
Mouse   135 VASWAKVLFLCCLPAQLPNICLEIQSKLNKHCTVYSFVSAIPLPRLKSLLN 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5cr-2NP_650632.1 PLN02688 6..270 CDD:178291 33/116 (28%)
F420_oxidored 8..101 CDD:281759 29/102 (28%)
P5CR_dimer 163..267 CDD:291418
Noxred1NP_082020.1 NADB_Rossmann 82..160 CDD:304358 26/88 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.