DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr-2 and Noxred1

DIOPT Version :9

Sequence 1:NP_650632.1 Gene:P5cr-2 / 42106 FlyBaseID:FBgn0038516 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_006240463.1 Gene:Noxred1 / 681924 RGDID:1589353 Length:367 Species:Rattus norvegicus


Alignment Length:147 Identity:38/147 - (25%)
Similarity:63/147 - (42%) Gaps:18/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IGFLGGGNMAKALAKGFLAAGLAKPNTLIASVHPADKLSLQSFQSLGVETVIKNAPVVQQSDVVF 71
            :|.:|.|::.:.|....|......|..|..|....|  ||...:.|||..|..||.|...:.|:|
  Rat    81 VGVIGCGHIGRQLTNVLLKTVSIPPENLQISTRRPD--SLVELRKLGVRCVYDNAAVANWAKVLF 143

  Fly    72 VSVKPQVVPSVLSEIQ-PLSSGKLFLSVAMGITLSTIESSLS------PQARVIRVMPNL----- 124
            :...|..:|::..||| .|....:..|....||:..:::.|:      ||.:.:....|:     
  Rat   144 LCCLPAQLPNICLEIQSKLDKSCIVYSFVSAITIPRLKTLLNHTNIVRPQYQFVEKFENIWGENE 208

  Fly   125 --PAVVCSGCSVFVRGS 139
              ||.:.:  |..:||:
  Rat   209 EVPAALRN--SSIIRGT 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5cr-2NP_650632.1 PLN02688 6..270 CDD:178291 38/147 (26%)
F420_oxidored 8..101 CDD:281759 27/93 (29%)
P5CR_dimer 163..267 CDD:291418
Noxred1XP_006240463.1 NADB_Rossmann 82..160 CDD:304358 24/79 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341873
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.