DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr-2 and PYCR3

DIOPT Version :9

Sequence 1:NP_650632.1 Gene:P5cr-2 / 42106 FlyBaseID:FBgn0038516 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_075566.3 Gene:PYCR3 / 65263 HGNCID:25846 Length:274 Species:Homo sapiens


Alignment Length:267 Identity:118/267 - (44%)
Similarity:168/267 - (62%) Gaps:3/267 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIGFLGGGNMAKALAKGFLAAGLAKPNTLIASVHPADKLSLQSFQSLGVETVIKNAPVVQQSDVV 70
            ::||:|.|.||.|:|:|.:.||..:...::||. |.|: :|..||:||..|...|..|:|...:|
Human    10 RVGFVGAGRMAGAIAQGLIRAGKVEAQHILASA-PTDR-NLCHFQALGCRTTHSNQEVLQSCLLV 72

  Fly    71 FVSVKPQVVPSVLSEIQP-LSSGKLFLSVAMGITLSTIESSLSPQARVIRVMPNLPAVVCSGCSV 134
            ..:.||.|:|:||:|:.| :::..:.:|||.|::|||:|..|.|..||:||:||||.||..|..|
Human    73 IFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVVQEGAIV 137

  Fly   135 FVRGSKATDADADITQKLLQSVGTCEPVDESQLDVVTALSGSGPAYVFVMIEALADGAVHMGMPR 199
            ..||.....::..:.|.||::.|.||.|.|:.:|:.|.|||||.|:|....||||:|||.||||.
Human   138 MARGRHVGSSETKLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPS 202

  Fly   200 DLAYRLASQTVLGAGHMVRDSGMHPGQLKDGVTSPAGSTAAALRQLELSGFRAAVSGAVEQATLR 264
            .||:|:|:||:||...|:...|.||.||:..|.:|.|:|...|..||..|.|||...|||.||.|
Human   203 SLAHRIAAQTLLGTAKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCR 267

  Fly   265 CRQISGK 271
            .:::|.|
Human   268 AKELSRK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5cr-2NP_650632.1 PLN02688 6..270 CDD:178291 116/264 (44%)
F420_oxidored 8..101 CDD:281759 36/93 (39%)
P5CR_dimer 163..267 CDD:291418 52/103 (50%)
PYCR3NP_075566.3 P5CR_dimer 10..273 CDD:330785 116/264 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10945
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56130
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1487
OMA 1 1.010 - - QHG60612
OrthoDB 1 1.010 - - D581707at33208
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 1 1.000 - - otm42074
orthoMCL 1 0.900 - - OOG6_100382
Panther 1 1.100 - - O PTHR11645
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R884
SonicParanoid 1 1.000 - - X667
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.