DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr-2 and PYCR1

DIOPT Version :9

Sequence 1:NP_650632.1 Gene:P5cr-2 / 42106 FlyBaseID:FBgn0038516 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001269210.1 Gene:PYCR1 / 5831 HGNCID:9721 Length:346 Species:Homo sapiens


Alignment Length:279 Identity:123/279 - (44%)
Similarity:173/279 - (62%) Gaps:11/279 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAIGK-------IGFLGGGNMAKALAKGFLAAGLAKPNTLIASVHPADKLSLQSFQSLGVETVI 58
            :.|:|:       :||:|.|.:|.||||||.|||:...:.::||....|..::.:.:.:||:...
Human    17 VGALGQGSPDSMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTP 81

  Fly    59 KNAPVVQQSDVVFVSVKPQVVPSVLSEI-QPLSSGKLFLSVAMGITLSTIESSLS---PQARVIR 119
            .|...||.|||:|::|||.::|.:|.|| ..:....:.:|.|.|:|:|:||..||   |..||||
Human    82 HNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIR 146

  Fly   120 VMPNLPAVVCSGCSVFVRGSKATDADADITQKLLQSVGTCEPVDESQLDVVTALSGSGPAYVFVM 184
            .|.|.|.||..|.:|:..|:.|...|..:.::||.|||.|..|:|..:|.||.||||||||.|..
Human   147 CMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTA 211

  Fly   185 IEALADGAVHMGMPRDLAYRLASQTVLGAGHMVRDSGMHPGQLKDGVTSPAGSTAAALRQLELSG 249
            ::|||||.|.||:||.||.||.:|.:|||..|:..|..|||||||.|:||.|:|..||..||..|
Human   212 LDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGG 276

  Fly   250 FRAAVSGAVEQATLRCRQI 268
            ||:.:..|||.:.:|.|::
Human   277 FRSLLINAVEASCIRTREL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5cr-2NP_650632.1 PLN02688 6..270 CDD:178291 121/274 (44%)
F420_oxidored 8..101 CDD:281759 35/93 (38%)
P5CR_dimer 163..267 CDD:291418 56/103 (54%)
PYCR1NP_001269210.1 P5CR_dimer 28..295 CDD:330785 121/266 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9449
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 226 1.000 Inparanoid score I3499
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60612
OrthoDB 1 1.010 - - D581707at33208
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 1 1.000 - - otm42074
orthoMCL 1 0.900 - - OOG6_100382
Panther 1 1.100 - - LDO PTHR11645
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R884
SonicParanoid 1 1.000 - - X667
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.