DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr-2 and pycr3

DIOPT Version :9

Sequence 1:NP_650632.1 Gene:P5cr-2 / 42106 FlyBaseID:FBgn0038516 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001038403.1 Gene:pycr3 / 560682 ZFINID:ZDB-GENE-041014-244 Length:288 Species:Danio rerio


Alignment Length:269 Identity:118/269 - (43%)
Similarity:165/269 - (61%) Gaps:3/269 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIGFLGGGNMAKALAKGFLAAGLAKPNTLIASVHPADKLSLQSFQSLGVETVIKNAPVVQQSDVV 70
            ||||:|.||||..:|:|.:|:|...|:.:|.|....:  :|..|:..||.....|..||..|.::
Zfish    20 KIGFIGAGNMAFGVAQGIIASGKVPPSNIIISAPSMN--NLPRFKEKGVSVTHSNHEVVGGSRLI 82

  Fly    71 FVSVKPQVVPSVLSEI-QPLSSGKLFLSVAMGITLSTIESSLSPQARVIRVMPNLPAVVCSGCSV 134
            |::|||.::|.||.|| |.::...:.:|:|.|||::|:|..|.....|||:|||||.::..|..:
Zfish    83 FLAVKPHIIPQVLKEISQEVTKEHIIVSMAAGITIATLEELLPAGTHVIRIMPNLPCMLLEGALL 147

  Fly   135 FVRGSKATDADADITQKLLQSVGTCEPVDESQLDVVTALSGSGPAYVFVMIEALADGAVHMGMPR 199
            ...||.|.:.:..:.:.||...|..|...||.:|....|||||.|:|:|..||||||||.||||.
Zfish   148 LSCGSHAGEQEETLLKTLLGPCGLVEFGPESWIDAHVGLSGSGVAFVYVFAEALADGAVKMGMPS 212

  Fly   200 DLAYRLASQTVLGAGHMVRDSGMHPGQLKDGVTSPAGSTAAALRQLELSGFRAAVSGAVEQATLR 264
            .||.|:|:||:||||.::||||..|.:||..|.:|.|:|...:..||..|||||..||||.|:.|
Zfish   213 TLARRIAAQTILGAGVLLRDSGKLPAELKAEVCTPGGTTIHGIHALEKGGFRAAAIGAVEAASER 277

  Fly   265 CRQISGKTK 273
            .|::..|.|
Zfish   278 ARELGNKQK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5cr-2NP_650632.1 PLN02688 6..270 CDD:178291 116/264 (44%)
F420_oxidored 8..101 CDD:281759 34/93 (37%)
P5CR_dimer 163..267 CDD:291418 57/103 (55%)
pycr3NP_001038403.1 PLN02688 20..283 CDD:178291 116/264 (44%)
F420_oxidored 22..114 CDD:281759 34/93 (37%)
P5CR_dimer 176..280 CDD:291418 57/103 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56130
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60612
OrthoDB 1 1.010 - - D581707at33208
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100382
Panther 1 1.100 - - O PTHR11645
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R884
SonicParanoid 1 1.000 - - X667
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.