DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr-2 and Pycr2

DIOPT Version :9

Sequence 1:NP_650632.1 Gene:P5cr-2 / 42106 FlyBaseID:FBgn0038516 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001012208.1 Gene:Pycr2 / 364064 RGDID:1310074 Length:320 Species:Rattus norvegicus


Alignment Length:266 Identity:116/266 - (43%)
Similarity:167/266 - (62%) Gaps:4/266 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IGFLGGGNMAKALAKGFLAAGLAKPNTLIASVHPADKLSLQSFQSLGVETVIKNAPVVQQSDVVF 71
            :||:|.|.:|.|||:||.|||:...:.:|||....|..::.:.:.:||.....|...|:.|||:|
  Rat     3 VGFIGAGQLACALARGFTAAGVLSAHKIIASSPEMDLPTVSALRKMGVNLTRSNKDTVRHSDVLF 67

  Fly    72 VSVKPQVVPSVLSEI-QPLSSGKLFLSVAMGITLSTIESSL---SPQARVIRVMPNLPAVVCSGC 132
            ::|||.::|.:|.|| ..:....:.:|.|.|:|:|::|..|   .|..:|||.|.|.|.||..|.
  Rat    68 LAVKPHIIPFILDEIGADVQERHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVREGA 132

  Fly   133 SVFVRGSKATDADADITQKLLQSVGTCEPVDESQLDVVTALSGSGPAYVFVMIEALADGAVHMGM 197
            :|:..|:.|...|..:.::|:.|||.|..|:|..:|.:|.||||||||.|:.::|||||.|.||:
  Rat   133 TVYATGTHALVEDGKLLEQLMSSVGFCTEVEEDLIDAITGLSGSGPAYAFMALDALADGGVKMGV 197

  Fly   198 PRDLAYRLASQTVLGAGHMVRDSGMHPGQLKDGVTSPAGSTAAALRQLELSGFRAAVSGAVEQAT 262
            ||.||.||.:|.:|||..|:.||..|||||||.|.||.|:|..||..||..|||:.:..|||.:.
  Rat   198 PRRLAVRLGAQALLGAAKMLLDSEDHPGQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASC 262

  Fly   263 LRCRQI 268
            :|.|::
  Rat   263 IRTREL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5cr-2NP_650632.1 PLN02688 6..270 CDD:178291 116/266 (44%)
F420_oxidored 8..101 CDD:281759 34/93 (37%)
P5CR_dimer 163..267 CDD:291418 56/103 (54%)
Pycr2NP_001012208.1 PLN02688 1..268 CDD:178291 116/264 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9391
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60612
OrthoDB 1 1.010 - - D581707at33208
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100382
Panther 1 1.100 - - O PTHR11645
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X667
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.