DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr-2 and PYCR2

DIOPT Version :9

Sequence 1:NP_650632.1 Gene:P5cr-2 / 42106 FlyBaseID:FBgn0038516 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_037460.2 Gene:PYCR2 / 29920 HGNCID:30262 Length:320 Species:Homo sapiens


Alignment Length:266 Identity:114/266 - (42%)
Similarity:167/266 - (62%) Gaps:4/266 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IGFLGGGNMAKALAKGFLAAGLAKPNTLIASVHPADKLSLQSFQSLGVETVIKNAPVVQQSDVVF 71
            :||:|.|.:|.|||:||.|||:...:.:|||....:..::.:.:.:||.....|...|:.|||:|
Human     3 VGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTRSNKETVKHSDVLF 67

  Fly    72 VSVKPQVVPSVLSEI-QPLSSGKLFLSVAMGITLSTIESSL---SPQARVIRVMPNLPAVVCSGC 132
            ::|||.::|.:|.|| ..:.:..:.:|.|.|:|:|::|..|   .|..:|||.|.|.|.||..|.
Human    68 LAVKPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVQEGA 132

  Fly   133 SVFVRGSKATDADADITQKLLQSVGTCEPVDESQLDVVTALSGSGPAYVFVMIEALADGAVHMGM 197
            :|:..|:.|...|..:.::|:.|||.|..|:|..:|.||.||||||||.|:.::|||||.|.||:
Human   133 TVYATGTHALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGL 197

  Fly   198 PRDLAYRLASQTVLGAGHMVRDSGMHPGQLKDGVTSPAGSTAAALRQLELSGFRAAVSGAVEQAT 262
            ||.||.:|.:|.:|||..|:.||..||.||||.|.||.|:|..||..||..|||:.:..|||.:.
Human   198 PRRLAIQLGAQALLGAAKMLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASC 262

  Fly   263 LRCRQI 268
            :|.|::
Human   263 IRTREL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5cr-2NP_650632.1 PLN02688 6..270 CDD:178291 114/266 (43%)
F420_oxidored 8..101 CDD:281759 33/93 (35%)
P5CR_dimer 163..267 CDD:291418 55/103 (53%)
PYCR2NP_037460.2 PLN02688 1..268 CDD:178291 114/264 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9449
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 226 1.000 Inparanoid score I3499
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60612
OrthoDB 1 1.010 - - D581707at33208
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 1 1.000 - - otm42074
orthoMCL 1 0.900 - - OOG6_100382
Panther 1 1.100 - - O PTHR11645
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R884
SonicParanoid 1 1.000 - - X667
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.