DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr-2 and Pycr1

DIOPT Version :9

Sequence 1:NP_650632.1 Gene:P5cr-2 / 42106 FlyBaseID:FBgn0038516 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001366015.1 Gene:Pycr1 / 209027 MGIID:2384795 Length:339 Species:Mus musculus


Alignment Length:266 Identity:116/266 - (43%)
Similarity:167/266 - (62%) Gaps:4/266 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IGFLGGGNMAKALAKGFLAAGLAKPNTLIASVHPADKLSLQSFQSLGVETVIKNAPVVQQSDVVF 71
            :||:|.|.:|.||||||.|||:...:.::||....|:.::.:.:.:||.....|...|:.|||:|
Mouse    33 VGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDQATVSALRKIGVNLTPHNKETVRHSDVLF 97

  Fly    72 VSVKPQVVPSVLSEI-QPLSSGKLFLSVAMGITLSTIESSLS---PQARVIRVMPNLPAVVCSGC 132
            ::|||.::|.:|.|| ..:....:.:|.|.|:|:::||..|:   |..:|||.|.|.|.||..|.
Mouse    98 LAVKPHIIPFILDEIGANIEDRHIVVSCAAGVTINSIEKKLTAFQPAPKVIRCMTNTPVVVREGV 162

  Fly   133 SVFVRGSKATDADADITQKLLQSVGTCEPVDESQLDVVTALSGSGPAYVFVMIEALADGAVHMGM 197
            :|:..|:.|...|..:.::|:.|||.|..|:|..:|.||.||||||||.|..::|||||.|.||:
Mouse   163 TVYATGTHAQVEDGRLVEQLMGSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGL 227

  Fly   198 PRDLAYRLASQTVLGAGHMVRDSGMHPGQLKDGVTSPAGSTAAALRQLELSGFRAAVSGAVEQAT 262
            ||.||.||.:|.:|||..|:.||..||.||||.|.||.|:|..||..||..|||:.:..|||.:.
Mouse   228 PRRLAVRLGAQALLGAAKMLLDSEQHPSQLKDNVCSPGGATIHALHVLESGGFRSLLINAVEASC 292

  Fly   263 LRCRQI 268
            :|.|::
Mouse   293 IRTREL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5cr-2NP_650632.1 PLN02688 6..270 CDD:178291 116/266 (44%)
F420_oxidored 8..101 CDD:281759 34/93 (37%)
P5CR_dimer 163..267 CDD:291418 56/103 (54%)
Pycr1NP_001366015.1 PLN02688 31..298 CDD:178291 116/264 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9520
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60612
OrthoDB 1 1.010 - - D581707at33208
OrthoFinder 1 1.000 - - FOG0001010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100382
Panther 1 1.100 - - LDO PTHR11645
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X667
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.