DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5cr-2 and NOXRED1

DIOPT Version :9

Sequence 1:NP_650632.1 Gene:P5cr-2 / 42106 FlyBaseID:FBgn0038516 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001106946.1 Gene:NOXRED1 / 122945 HGNCID:20487 Length:359 Species:Homo sapiens


Alignment Length:264 Identity:62/264 - (23%)
Similarity:102/264 - (38%) Gaps:59/264 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIGFLGGGNMAKALAKGFLAAGLAKPNTLIASVHPADKLSLQSFQSLGVETVIKNAPVVQQSDVV 70
            |:|.:|||::.|.||...|..|.....:|..|....:  :|...|.||::....||.:|..:||:
Human    78 KVGIIGGGHLGKQLAGTLLQLGPIPAESLRISTRRPE--TLGELQKLGIKCFYHNADLVSWADVI 140

  Fly    71 FVSVKPQVVPSVLSEI-QPLSSGKLFLSVAMGITLSTIESSLSPQARVIRVMPNLPAVVCSGCSV 134
            |:...|..:|::..|| ..|....:..|....|.|..::..|: ...::|     |.......||
Human   141 FLCCLPSQLPNICVEIYTSLEKASIVYSFVAAIPLPRLKLLLN-HTNILR-----PQYQYDEDSV 199

  Fly   135 FVRGSK----ATDADADITQKLLQSVGTCEPVDESQLDVVTALSGSGPAYVFVM----IEALADG 191
            .|.|:.    |...|..|.|      .||.               ..||...::    :|.:...
Human   200 SVWGANKGVIAALQDPTILQ------ATCP---------------YSPAGGIILNIKWLEGVFYA 243

  Fly   192 AVHMGMPRDLAY----RLASQTVLGAGHMVRDSGMHPGQLKDGVTSPAGSTAAALRQLELSGFRA 252
            |:::...|::|:    :|.|:..|.. |. .|.|      ||..:.|         :|:|:.|.:
Human   244 ALNICTARNMAHSQVLQLLSELFLSV-HF-EDCG------KDTASCP---------KLQLTDFVS 291

  Fly   253 AVSG 256
            ...|
Human   292 KAYG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5cr-2NP_650632.1 PLN02688 6..270 CDD:178291 62/264 (23%)
F420_oxidored 8..101 CDD:281759 27/93 (29%)
P5CR_dimer 163..267 CDD:291418 19/102 (19%)
NOXRED1NP_001106946.1 F420_oxidored 80..168 CDD:281759 26/89 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148001
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.