DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5823 and UBC33

DIOPT Version :9

Sequence 1:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001032048.2 Gene:UBC33 / 835111 AraportID:AT5G50430 Length:243 Species:Arabidopsis thaliana


Alignment Length:169 Identity:82/169 - (48%)
Similarity:123/169 - (72%) Gaps:0/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QPTAVSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFK 76
            :...:.|::::|..|.::|:.::.|.|.||:||||||.::|.|.:|:.||:|:|.:.||.|:|:|
plant     3 EKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKFPPEYPYK 67

  Fly    77 PPSIYMLTPNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTPTLGSIESSNYDK 141
            ||.|.|.||||||.|..::|||:|||||::|||.|.|.:|||||||||::::||.||:.:|..:|
plant    68 PPGITMTTPNGRFVTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDNSPTTGSVNTSVAEK 132

  Fly   142 QMFAQKSLAFNLRNTNFCELFPEIVEEIKQRLRGTQAAA 180
            |..|:.|||||.::..|.:||||.||:..|:....:.||
plant   133 QRLAKSSLAFNCKSVTFRKLFPEYVEKYSQQQVAEEEAA 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 59/112 (53%)
UBC33NP_001032048.2 COG5078 1..161 CDD:227410 79/157 (50%)
UBCc 7..157 CDD:238117 77/149 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 155 1.000 Domainoid score I1337
eggNOG 1 0.900 - - E1_KOG0894
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10975
Inparanoid 1 1.050 193 1.000 Inparanoid score I1362
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1230974at2759
OrthoFinder 1 1.000 - - FOG0004329
OrthoInspector 1 1.000 - - otm3206
orthoMCL 1 0.900 - - OOG6_101978
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3056
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.