DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5823 and UBC33

DIOPT Version :10

Sequence 1:NP_650631.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_199854.1 Gene:UBC33 / 835111 AraportID:AT5G50430 Length:243 Species:Arabidopsis thaliana


Alignment Length:169 Identity:82/169 - (48%)
Similarity:123/169 - (72%) Gaps:0/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QPTAVSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFK 76
            :...:.|::::|..|.::|:.::.|.|.||:||||||.::|.|.:|:.||:|:|.:.||.|:|:|
plant     3 EKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKFPPEYPYK 67

  Fly    77 PPSIYMLTPNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTPTLGSIESSNYDK 141
            ||.|.|.||||||.|..::|||:|||||::|||.|.|.:|||||||||::::||.||:.:|..:|
plant    68 PPGITMTTPNGRFVTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDNSPTTGSVNTSVAEK 132

  Fly   142 QMFAQKSLAFNLRNTNFCELFPEIVEEIKQRLRGTQAAA 180
            |..|:.|||||.::..|.:||||.||:..|:....:.||
plant   133 QRLAKSSLAFNCKSVTFRKLFPEYVEKYSQQQVAEEEAA 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5823NP_650631.1 UBCc_UBE2J 18..149 CDD:467419 67/130 (52%)
UBC33NP_199854.1 UBCc_UBE2J 8..140 CDD:467419 67/131 (51%)

Return to query results.
Submit another query.