DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5823 and UBC32

DIOPT Version :9

Sequence 1:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_566563.1 Gene:UBC32 / 820956 AraportID:AT3G17000 Length:309 Species:Arabidopsis thaliana


Alignment Length:306 Identity:97/306 - (31%)
Similarity:146/306 - (47%) Gaps:52/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RKQPTAVSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFP 74
            ||.| ||.|:.|:...::.:|.....:.||..||.||.:.::||.|:.:.||.|||.:..|.::|
plant     8 RKNP-AVKRILQEVKEMQANPSDDFMSLPLEENIFEWQFAIRGPGDTEFEGGIYHGRIQLPADYP 71

  Fly    75 FKPPSIYMLTPNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTPTLGSIESSNY 139
            |||||..:|||||||:|||::|||||::||:.|.|:|.|.|.|..|::||  .|...|::.|.:|
plant    72 FKPPSFMLLTPNGRFETNTKICLSISNYHPEHWQPSWSVRTALVALIAFM--PTSPNGALGSVDY 134

  Fly   140 DKQMFAQKSLAFNLRNTNFCELFPE---IVEEIKQRLRGTQAAAAVDGPAANGVKRSNGLANGA- 200
            .|.  .:::||...|.|......||   |::||.|.:  ...|..|..|......::..:.:.| 
plant   135 PKD--ERRTLAIKSRETPPKYGSPERQKIIDEIHQYI--LSKATVVPKPLPLECSQAPSIVSEAH 195

  Fly   201 ---------------SLASADG--------------NLA--VGGLANPLNAAD-AIDGGAAGQAD 233
                           |:|:.|.              |.|  |...|.||.|.: .:....:|:..
plant   196 SQVEPQEAITVVEERSIATTDTIVDDQIIEETAEAVNTAASVVPAAAPLPAVEVVVKASVSGEQR 260

  Fly   234 LASGGGAAVQNSARNSYLNWQSVYSNLVIIICFAIFALIVNYVIKN 279
            :|.   .|.|....:....|.:|  .|.|    ||..|::...||:
plant   261 MAR---RAAQKPVDDRLFTWAAV--GLTI----AIMVLLLKKFIKS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 51/112 (46%)
UBC32NP_566563.1 UBCc 13..152 CDD:238117 60/142 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1230974at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.