DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5823 and CG46338

DIOPT Version :9

Sequence 1:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_524888.1 Gene:CG46338 / 47272 FlyBaseID:FBgn0285962 Length:244 Species:Drosophila melanogaster


Alignment Length:240 Identity:54/240 - (22%)
Similarity:80/240 - (33%) Gaps:67/240 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFKP--PSIY--- 81
            :|..::.:.|..|...|...|.|:|.....| ....|....:..|:|.|..||...  |||.   
  Fly    28 EYKMIESEKLSGIYVIPSYANSLQWFGVFFG-RQGLYAESVFRFTILLPDRFPDDKSLPSIIFQQ 91

  Fly    82 -MLTPNGRFKTNTRLC-----LSISDFHPDTWNPTWCVGTILTGLLSFM--LESTPTLGSIESSN 138
             ::.|:        :|     |.:|...|: |.   |....|..||.::  :.|.| |.||....
  Fly    92 DVIHPH--------VCPYTHSLDVSHAFPE-WR---CGEDHLWQLLKYLQVIFSDP-LDSIRGIE 143

  Fly   139 YDKQMFAQKSLAFNLRNTNFCELF-----------PEIVEEIKQRLRGT------------QAAA 180
            .||           |:|:...||.           .|.::|.|:.:..|            :...
  Fly   144 VDK-----------LKNSEAAELLMNNKEEYVARVQENIKESKEHIFDTPPTEDPHYIVFEKFQQ 197

  Fly   181 AVDGPAANGVKRSNGLANGASLASADGNLAVG------GLANPLN 219
            .|.||....:|.........|...|:|..|.|      |...||:
  Fly   198 DVHGPVLERIKAGRSKLTEPSAQQANGGHATGLSWVKEGEFKPLS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 28/119 (24%)
CG46338NP_524888.1 UBCc 19..169 CDD:294101 38/165 (23%)
COG5078 24..176 CDD:227410 40/172 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438166
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.