DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5823 and CG7656

DIOPT Version :9

Sequence 1:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster


Alignment Length:217 Identity:59/217 - (27%)
Similarity:92/217 - (42%) Gaps:49/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSSTSGGRKQPT------AVSRMKQDYMRLKRDPLPYITAEPL-PNNILEWHYCVKGPEDSPYYG 60
            |.:||.....||      ||..:..:|..|:.:|:.....:.: .:|:.||...:.||.|:.|.|
  Fly    23 SLATSSSAAAPTTTPSSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQG 87

  Fly    61 GYYHGTLLFPREFPFKPPSIYMLT----PNGRFKTNTRLCLSISDFHP------------DTWNP 109
            ||:...:.||.::|:.||||..||    ||  ...|..||:||  .||            :.|||
  Fly    88 GYFKAHMKFPHDYPYSPPSIRFLTKVWHPN--VYENGDLCISI--LHPPVDDPQSGELPCERWNP 148

  Fly   110 TWCVGTILTGLLSFMLESTPTLGSIESSNYDKQMFAQKSLAFNLRNTNFCELFPEIVEEIKQRLR 174
            |..|.|||..::|.:.|.    .:...:|.|..:..::......::..    :|.|:.  ||.| 
  Fly   149 TQNVRTILLSVISLLNEP----NTFSPANVDASVMYRRWRDSQGKDNE----YPNIIR--KQAL- 202

  Fly   175 GTQAAAAVDGPAANGVKRSNGL 196
                       |||...:..|:
  Fly   203 -----------AANAEAKREGI 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 42/129 (33%)
CG7656NP_648783.4 UBCc 42..186 CDD:238117 44/151 (29%)
COG5078 45..182 CDD:227410 43/144 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438204
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.