DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5823 and Ubc4

DIOPT Version :9

Sequence 1:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster


Alignment Length:207 Identity:54/207 - (26%)
Similarity:82/207 - (39%) Gaps:39/207 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AVSRMKQDY---MRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFK 76
            ||||:|:::   ||.:......|..|.:.::..|....:.||.|:||.||.:...:..|..:||.
  Fly     5 AVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFN 69

  Fly    77 PPSIYMLT----PNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTPTLGSIESS 137
            ||.:..:|    ||....|.. :||   |...|.|.....:.|:|..|.:.:..:.|.       
  Fly    70 PPKVRFITRIWHPNISSVTGA-ICL---DILKDNWAAAMTLRTVLLSLQALLAAAEPD------- 123

  Fly   138 NYDKQ------MFAQKSLAFNLRNTNFC-------ELFPEIVEEIKQRLRGT-----QAAAAVDG 184
              |.|      .|..|...|.|...::.       ..||:...:| ||||..     :|.|.:..
  Fly   124 --DPQDAVVAYQFKDKYDLFLLTAKHWTNAYAGGPHTFPDCDSKI-QRLRDMGIDEHEARAVLSK 185

  Fly   185 PAANGVKRSNGL 196
            ...|..|.:.||
  Fly   186 ENWNLEKATEGL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 33/119 (28%)
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 41/160 (26%)
UQ_con 8..149 CDD:278603 38/153 (25%)
UBA_II_E2_UBCD4 163..198 CDD:270574 11/36 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438056
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.