DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5823 and CG16894

DIOPT Version :9

Sequence 1:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_611455.1 Gene:CG16894 / 37280 FlyBaseID:FBgn0034483 Length:266 Species:Drosophila melanogaster


Alignment Length:190 Identity:37/190 - (19%)
Similarity:68/190 - (35%) Gaps:59/190 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AVSRMKQDY-----MRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFP 74
            :::.:||.|     ..|.::.|..|.|.|.....|.| :.|.......|.|..:..::|.|..||
  Fly    10 SIALIKQGYHILAEYNLVKEELKNIYAIPSYACGLHW-FGVIFVHSGIYAGSVFRFSILLPENFP 73

  Fly    75 --FKPPSIYMLTPNGRFKTNTRLC-----LSISDFHPDTW----NPTWCV------------GTI 116
              ...|::...|.    ..:..:|     |.::.| .:.|    :..|.|            |:|
  Fly    74 ADISLPTVVFSTE----VLHPHICPQNKTLDLAHF-LNEWRKDEHHIWHVLRYIQAIFADPEGSI 133

  Fly   117 LTGLLSFMLESTPTLGSIESSNYDKQMFAQKSLAFNLRNTNFCELF----PEIVEEIKQR 172
            .||               :||:.|..:..:      :||.|...:.    ||.::.::::
  Fly   134 CTG---------------QSSSGDLVIMDE------VRNMNALNMLAKSRPEYIKRVQEQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 29/140 (21%)
CG16894NP_611455.1 COG5078 20..176 CDD:227410 34/180 (19%)
UBCc 23..173 CDD:294101 34/177 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438167
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.