DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5823 and Ubc10

DIOPT Version :9

Sequence 1:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster


Alignment Length:123 Identity:33/123 - (26%)
Similarity:56/123 - (45%) Gaps:14/123 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TAVSRMKQDYMRLKRDPLPY---ITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPF 75
            ||..|::::...|:.:.|..   |.|:  .:|:|.|...:. |::.||..|.:...:.||.|:||
  Fly     2 TAPRRLRKELSDLQGNALKSFRDIKAD--DDNLLRWTGLIV-PDNPPYNKGAFRIEINFPAEYPF 63

  Fly    76 KPPSIYMLT----PNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTP 129
            |||.|...|    ||  .....::||.|  ...:.|.|......::..|:..:.:..|
  Fly    64 KPPKINFKTRIYHPN--IDEKGQVCLPI--ISTENWKPATRTDQVVQALVDLINDPEP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 30/119 (25%)
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 31/119 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.