DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5823 and CG3473

DIOPT Version :9

Sequence 1:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster


Alignment Length:116 Identity:38/116 - (32%)
Similarity:57/116 - (49%) Gaps:9/116 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFKPPSIYM 82
            |:.::..||..||:|.|:|.|...|...:|..|.||:|||:.||.:...|..|.::|.|.|.:..
  Fly     7 RIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRF 71

  Fly    83 LT----PNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTP 129
            ||    ||  .....|:||   |...|.|:|...:.|:|..:.:.:....|
  Fly    72 LTKIFHPN--IDRVGRICL---DILKDKWSPALQIRTVLLSIQALLSAPNP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 37/114 (32%)
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 38/116 (33%)
COG5078 7..149 CDD:227410 38/116 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438126
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.