DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5823 and CG8188

DIOPT Version :9

Sequence 1:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster


Alignment Length:158 Identity:33/158 - (20%)
Similarity:63/158 - (39%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSSTSGGRKQPTAVSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHG 65
            |||..::.....|..:.::.::...::..|...|......:::.:....:.||..:||..|.:..
  Fly     1 MSSQYSNVENLSPQTIRQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGIFRV 65

  Fly    66 TLLFPREFPFKPPSIYMLT----PNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLE 126
            .|...::||..||..|.||    ||  ...|..:|  ::....| |.|...:..||..:...::.
  Fly    66 KLTLNKDFPLTPPKAYFLTKIFHPN--VAANGEIC--VNTLKKD-WKPDLGIKHILLTIKCLLIV 125

  Fly   127 STP------TLGSIESSNYDKQMFAQKS 148
            ..|      ..|.:....||.  ::|::
  Fly   126 PNPESALNEEAGKMLLERYDD--YSQRA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 24/116 (21%)
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 30/147 (20%)
UBCc 16..155 CDD:238117 29/143 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.