DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5823 and Ube2j1

DIOPT Version :9

Sequence 1:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001100112.2 Gene:Ube2j1 / 297961 RGDID:1305067 Length:318 Species:Rattus norvegicus


Alignment Length:308 Identity:92/308 - (29%)
Similarity:144/308 - (46%) Gaps:59/308 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KQPTAVSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPF 75
            |.| ||.|:.::...|| ||..:..|:||.:|:.|||:.|:||.||.:.||.|||.::.|.|:|.
  Rat     8 KSP-AVKRLMKEAAELK-DPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPM 70

  Fly    76 KPPSIYMLTPNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTPT-----LGSIE 135
            |||||.:||.||||:...::|||||..||:||.|:|.:.|.|..::.||    ||     :||::
  Rat    71 KPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFM----PTKGEGAIGSLD 131

  Fly   136 SSNYDKQMFAQKSLAFNLRNTNFC-----ELFPEIVEEIKQRLRGTQAAAAVDGPAANGVKRSNG 195
            .:..:::..|:||       .:||     ....:::..:|..:..:||.......|.....::..
  Rat   132 YTPEERRALAKKS-------QDFCCEGCGSAMKDVLLPLKSGIDSSQADQEAKELARQISFKAEV 189

  Fly   196 LANGASLASADGNLAV--------------GGLANPLNAADAIDGG--------AAGQADLASGG 238
            .::|.::|.:|.|.:.              |..|:....|....|.        |.....::...
  Rat   190 NSSGKTIAESDLNQSFSLNDSQDDLPTTFQGAAASTSYGAQNPSGAPLPQPTQPAPKNTSMSPRQ 254

  Fly   239 GAAVQNSARNS-----YLNWQSVYSN---------LVIIICFAIFALI 272
            ..|.|.|.|.|     .|..|...:|         |:||:..|:.|||
  Rat   255 RRAQQQSQRRSSASPDVLQGQPPRANHTEHGGSAMLIIILTLALAALI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 52/112 (46%)
Ube2j1NP_001100112.2 UBCc 12..>119 CDD:238117 50/107 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1230974at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.