DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5823 and ubc-6

DIOPT Version :9

Sequence 1:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001040755.1 Gene:ubc-6 / 174217 WormBaseID:WBGene00006703 Length:314 Species:Caenorhabditis elegans


Alignment Length:298 Identity:86/298 - (28%)
Similarity:144/298 - (48%) Gaps:37/298 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFKPPSI 80
            |.|:.::.|.| |.|.....|:|:.:|:.|||:.::|...:.:.||.|||.::||.::|.|||::
 Worm    12 VRRLMKEAMEL-RQPTEMYHAQPMEDNLFEWHFTIRGTLGTDFEGGIYHGRIIFPADYPMKPPNL 75

  Fly    81 YMLTPNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTP--TLGSIESSNYDKQM 143
            .:|||||||:.|.::|||||.:||:||.|:|.:.|.|..|:.| |.|||  .|||::....::|.
 Worm    76 ILLTPNGRFELNKKVCLSISGYHPETWLPSWSIRTALLALIGF-LPSTPGGALGSLDYPPKERQR 139

  Fly   144 FAQKSLAFNLRNTNFC----ELFPEIVE--EIKQRLRGTQAAAAVDGPAANGVKRSNGLAN---- 198
            .|:.|..:..:... |    .|.| |.|  ::||.......||.:.....:.||:....||    
 Worm   140 LAKLSCEWKCKECG-CVMKTALLP-ITEDGQLKQTEEAKTLAAQLKFQDESVVKKEVEAANNQKN 202

  Fly   199 ----------------GASLASADGNLAVGGLANPLNAADAIDGGAAGQADLASGGGAAVQNSA- 246
                            ....:..|.:....|....:|:::..|........:........|:.| 
 Worm   203 PTETEPSEETSSVPTENVEESEEDADEREEGTTVNVNSSEVPDVAQPAVQPIRDPQPLVFQHHAP 267

  Fly   247 --RNSYLNWQSVYSNLVIIICFAIFALIV--NYVIKNL 280
              .::..::..:|...||.:|||||..::  .:::.||
 Worm   268 RLASTNFDYTLLYKIPVIALCFAIFFTLLARRFLVDNL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 49/112 (44%)
ubc-6NP_001040755.1 UBCc 12..>121 CDD:238117 48/110 (44%)
rne <185..266 CDD:236766 9/80 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1230974at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.