DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5823 and Ube2j2

DIOPT Version :9

Sequence 1:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001034246.1 Gene:Ube2j2 / 140499 MGIID:2153608 Length:271 Species:Mus musculus


Alignment Length:296 Identity:151/296 - (51%)
Similarity:187/296 - (63%) Gaps:54/296 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSTSGGRKQPTAVSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLL 68
            |:.|..|...||..|:||||:|:|:||:|||.|||||:|||||||.|:|||.:||.||||||.|:
Mouse    14 SNNSNKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLI 78

  Fly    69 FPREFPFKPPSIYMLTPNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTPTLGS 133
            ||||||||||||||:|||||||.||||||||:|||||||||.|.|.||||||||||:|..|||||
Mouse    79 FPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGS 143

  Fly   134 IESSNYDKQMFAQKSLAFNLRNTNFCELFPEIVEEIKQRLRGTQAAA-----------AVDGP-- 185
            ||:|::.|:..|.:||.|||::..|||||||:||||||:.:.....:           ..||.  
Mouse   144 IETSDFTKKQLAAQSLVFNLKDKVFCELFPEVVEEIKQKQKAQDELSNRPQNLPLPDVVPDGELH 208

  Fly   186 -AANGVKRSNGLANGASLASADGNLAVGGLANPLNAADAIDGGAAGQADLASG--GGAAVQNSAR 247
             ..:|::..||.|     .:|..|||  ||.               ||:...|  |||       
Mouse   209 RGQHGIQLLNGHA-----PAAGPNLA--GLP---------------QANRHHGLLGGA------- 244

  Fly   248 NSYLNWQSVYSNLVIIICFAIFALIVNYVIKNLNQE 283
                     .:||.:|:.||.||..|.||::::.||
Mouse   245 ---------LANLFVIVGFAAFAYTVKYVLRSIAQE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 88/112 (79%)
Ube2j2NP_001034246.1 UBCc 26..139 CDD:238117 88/112 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838040
Domainoid 1 1.000 205 1.000 Domainoid score I2933
eggNOG 1 0.900 - - E1_KOG0894
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10975
Inparanoid 1 1.050 279 1.000 Inparanoid score I2901
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004329
OrthoInspector 1 1.000 - - oto92256
orthoMCL 1 0.900 - - OOG6_101978
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1584
SonicParanoid 1 1.000 - - X3056
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.780

Return to query results.
Submit another query.