DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5823 and UBE2J2

DIOPT Version :9

Sequence 1:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_024308790.1 Gene:UBE2J2 / 118424 HGNCID:19268 Length:292 Species:Homo sapiens


Alignment Length:303 Identity:139/303 - (45%)
Similarity:177/303 - (58%) Gaps:64/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSTSGGRKQPTAVSRMKQDYMRLKRDPL-------PYITAEPLPNNILEWHYCVKGPEDSPYYGG 61
            |:.||.:::|   |..::...|::|.||       |.:.....|.:|...||.|:|||.:||.||
Human    31 STFSGSQRRP---SPGRRRIPRVRRSPLATRVLSAPSVENHMWPQDIAGRHYVVRGPEMTPYEGG 92

  Fly    62 YYHGTLLFPREFPFKPPSIYMLTPNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLE 126
            ||||.|:||||||||||||||:|||||||.||||||||:|||||||||.|.|.||||||||||:|
Human    93 YYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE 157

  Fly   127 STPTLGSIESSNYDKQMFAQKSLAFNLRNTNFCELFPEIVEEIKQRLRGTQAAAA---------- 181
            ..|||||||:|::.|:..|.:||||||::..|||||||:||||||:.:.....::          
Human   158 KGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDV 222

  Fly   182 -VDGP---AANGVKRSNGLANGASLASADGNLAVGGLANPLNAADAIDGGAAGQADLASG--GGA 240
             .||.   ..||::..||.|.||.     .|||  ||.               ||:...|  |||
Human   223 VPDGETHLVQNGIQLLNGHAPGAV-----PNLA--GLQ---------------QANRHHGLLGGA 265

  Fly   241 AVQNSARNSYLNWQSVYSNLVIIICFAIFALIVNYVIKNLNQE 283
                            .:||.:|:.||.||..|.||::::.||
Human   266 ----------------LANLFVIVGFAAFAYTVKYVLRSIAQE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 74/119 (62%)
UBE2J2XP_024308790.1 UBCc <78..160 CDD:238117 66/81 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147953
Domainoid 1 1.000 205 1.000 Domainoid score I2939
eggNOG 1 0.900 - - E1_KOG0894
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10975
Inparanoid 1 1.050 284 1.000 Inparanoid score I2872
Isobase 1 0.950 - 0 Normalized mean entropy S649
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1230974at2759
OrthoFinder 1 1.000 - - FOG0004329
OrthoInspector 1 1.000 - - oto88688
orthoMCL 1 0.900 - - OOG6_101978
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1584
SonicParanoid 1 1.000 - - X3056
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.740

Return to query results.
Submit another query.