DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and Chl1

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:XP_038964701.1 Gene:Chl1 / 89828 RGDID:620122 Length:1224 Species:Rattus norvegicus


Alignment Length:1420 Identity:293/1420 - (20%)
Similarity:480/1420 - (33%) Gaps:499/1420 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KALLLGAL-LLAVLATPLLATSGLRVPTFLLEPAPRLLFGNDTGAQVTCTAHGSPPPLVTWVLRD 76
            :.|:|..: ||..|:|..:..|..:|||.:.:...::.|..|...|:.|.|.|:|.|..:|...|
  Rat     8 RGLILSLIFLLLKLSTAEIPLSVHQVPTIVKQSYVQVAFPFDEYFQIECEAKGNPEPKFSWTKDD 72

  Fly    77 GSLATQVPGLRKISGNGTLHFPPFLAQYYRTDVH----EATYRCRASNEAGTVLSRNVQVHAVVR 137
            .......|.:...:.:||...|        .:.|    :..|||.|||..||.:|..:       
  Rat    73 KPFDLSDPRIIAFNNSGTFRIP--------NEGHISHFQGKYRCFASNRLGTAISEEI------- 122

  Fly   138 RQFHVHVENTEVYLGNSALIKCAIPEYVRPYVRVASWHRGEEILLPDLSDVAGRYVVLAASGDLY 202
                                                     |.::|                   
  Rat   123 -----------------------------------------EFIVP------------------- 127

  Fly   203 VRSVRSEDGLMKFSCLVTNTLNGERQRSDAVMLQVKELSKNLAPRTTQKPVMEIHVERGNDVHLP 267
                    |:.||                              |:...:|   |.||.|:.:.||
  Rat   128 --------GVPKF------------------------------PKEKIEP---IDVEEGDSIVLP 151

  Fly   268 CN-IQGNPFPIFTWYRVSDSAALYPIPSSQRVILS-RTLLLIKNADERDA-GKWICQASNQFGE- 328
            || .:|:|.....|..:.    |..|...:||.:| :..|...|.:|:|: ..:.|.|:  |.: 
  Rat   152 CNPPKGHPPLHIYWMNIE----LEHIEQDERVYMSQKGDLYFANVEEKDSRNDYCCFAA--FPKL 210

  Fly   329 ----QRIEIRLSVNSYVSVH----------------------ILPQVQI-------VNSGGTANF 360
                |::.::|:|||....:                      :||..||       |..|.|...
  Rat   211 RTIVQKMPMKLTVNSLKHANDSSSSTEISNQANSIKQRKPKLLLPPAQIGSASSKTVLKGDTLLL 275

  Fly   361 NCTTTGSAIDAIDWLHNGKPLQANNALTTGRDNIRFLSKSSLLVQNVGRRDRGVYQCLVENQRAS 425
            .|...|.....|:|...|      :.|..||..|. :.:.:|.::||..:|||.|:|...|....
  Rat   276 ECFAEGLPTPQIEWSKLG------SELPKGRATIE-IHEKTLKIENVSYQDRGNYRCTANNLLGK 333

  Fly   426 AQAMAELKLGDTVPELIYTFIEQNVR-----------PGPLISLKCSASGSPPPQFAWLLDSQPI 479
            |.            ...:..:|:..|           .|....|.|.|.|.|.|...|.::..||
  Rat   334 AS------------HDFHVIVEEPPRWKKKPQSAVYSTGSNGILLCEAEGEPQPTIKWRVNGLPI 386

  Fly   480 MDVSLHHRFAIGQFVDMSGDVI--SHLNISHVRPDDGGLYKCVASNSMGSVQHSARLNVYG-PPY 541
            .    :|.|        .|||:  ..::.::::|:...:|:|.|||..|::..:|.::|.. .|.
  Rat   387 E----NHPF--------PGDVMFPREISFTNLQPNHTAVYQCEASNIHGTILANANIDVVDVVPL 439

  Fly   542 VRAIGP--IKAVAGEDIIVHCPFAGYPVEQIRWEKAHQELTTSNHYELASVADGGQLVIKNVEPG 604
            ::....  .:.|.|....:||.:...|...:.||                |||            
  Rat   440 IQTKNEENYETVVGYSAFLHCEYFASPKATVVWE----------------VAD------------ 476

  Fly   605 RDQGIYTCIVRSRAGEEARRDMQLNVNSPPVIEPFKFPKNLQEGGRAQITCAVSSGDMPIYFSWK 669
                                      .:.|:           ||||              |.:.:
  Rat   477 --------------------------ETHPL-----------EGGR--------------YHTHE 490

  Fly   670 KDDSSIPSSLQITEKKEEFYSLLVFKDISARHSGKYTCYASNAAAKVNYTAELQVRVAPRWRYEP 734
            .      .:|:|....||             .:|.|:|:..|...|...||.|.:|.|.:.|..|
  Rat   491 N------GTLEIERTTEE-------------DAGSYSCWVDNTMGKAVITANLDIRNATKLRVFP 536

  Fly   735 MDTAIMLGNTISINCEAEGYPIPTITWFKGQGKGSKDFKPLSMRNHSLLLNLATDNDEGYYMCQA 799
            .:..|...:.:.:.||::                                            |  
  Rat   537 KNPRIPKSHVLELYCESQ--------------------------------------------C-- 555

  Fly   800 TNEIGAGLKKTIRINVNEPARFEQSARNISSRRNDPVTLDCHAKGDEPITIGWTQNNGRIDLNNF 864
                                                   |.|.|  ..:.:.|:::....::|. 
  Rat   556 ---------------------------------------DSHLK--HSLKLSWSKDGEAFEMNG- 578

  Fly   865 RFSIAEMKTEKG---VD-SQLTIGHSDRHDSGVYRCIAENPYGRAE---QIIFLAVQERPDTPSH 922
                    ||.|   :| :.|||.:....|.|:|.|.|:.......   |:..|.|   ||.|.:
  Rat   579 --------TEDGRIVIDGANLTISNISGEDQGIYSCSAQTALDSTSGKTQVTVLGV---PDPPRN 632

  Fly   923 LEIFEVGSRTVKLSWRRPFDGNSPVLSYLVQYQALKYLQSHGSLAAAGGDWNGHVINVSLPSTSI 987
            |.:.|..:|:|:|||....|.||.:..|:|:::..:         ...|.|.           .:
  Rat   633 LLLSERQNRSVRLSWEAGDDHNSKISEYIVEFEGNR---------EEPGKWE-----------EL 677

  Fly   988 SRSYDSDLRESAIVAGLTPATTFLIRMQAINEIERSAYTE-AIVLKTQEEAPTEAPSNVQVQTGG 1051
            :|...   .|:.:|..|.|...:..|:.|:||:.:|..:: :...:|...||.:.|.|::||...
  Rat   678 TRVRG---EETDVVLPLAPYVRYQFRVTAVNEVGKSHSSQPSDHHETPPAAPDKNPHNIRVQASQ 739

  Fly  1052 ESELIVTWQIPPRESWNGELIGYTVN-----CSEEKQNINFISVVNSSLKSTIVSGW---ATTKA 1108
            ..|:|:.|:.......||..:.|.|:     ..||                     |   ..|..
  Rat   740 PKEMIIKWEPLKSMEQNGPGLEYRVSWKPQGAPEE---------------------WEEETVTNH 783

  Fly  1109 TLRGLRK--YSRYAVTIRAMNSFGSGPWSAAIFGTTAEGVPEAAPQNVNCTALSSQSLKISWLEP 1171
            |||.:..  |:.|.|.::|:|..||||....:...:.|..|..||.......::|..:|::|...
  Rat   784 TLRVMTPTVYAPYDVQVQAINQLGSGPEPQPVTLYSGEDYPSTAPVIHRVDVMNSTLVKVTWSSI 848

  Fly  1172 PLQFHGGIIQGYKILYRPIVHQID---FPAKLEIKRTSNLET--YLHTLHKASNYSIRVLAYTAT 1231
            |.:...|:::||:|.:......:|   .|.::.|.|.|....  .:.:|...|.:.:.||||.:.
  Rat   849 PKETVHGLLRGYQINWWKTKSLLDGRTHPKEVNILRFSGQRNSGMVPSLEPFSEFHLTVLAYNSK 913

  Fly  1232 GDGLASHPLFCQTDDDVPDAPAAIKAAALTADSILISWLTPKNRNGIISHYTVY------SREAG 1290
            |.|..|.|...||.:.||:.|:.:|...:..|:..:||..||..||.::.|.:.      :.|.|
  Rat   914 GAGPESEPYIFQTPEGVPEQPSFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYELG 978

  Fly  1291 RKGQAKTHMVRVDENGYPVTFESRS------LAENQMYEFWVSASTSVGEGEPTS 1339
                        :.|...||..|:|      |.....|:|::.|.||.|.|:|.|
  Rat   979 ------------ELNEINVTTPSKSSWHLSNLNATTKYKFYLKACTSRGCGKPIS 1021

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652 22/80 (28%)
Ig 56..125 CDD:143165 20/72 (28%)
I-set 246..337 CDD:254352 27/98 (28%)
Ig 264..334 CDD:143165 20/77 (26%)
I-set 345..433 CDD:254352 26/94 (28%)
Ig 358..431 CDD:143165 19/72 (26%)
Ig 456..533 CDD:143165 21/78 (27%)
IGc2 553..619 CDD:197706 9/65 (14%)
I-set 634..724 CDD:254352 18/89 (20%)
ig 645..712 CDD:278476 12/66 (18%)
IG_like 734..815 CDD:214653 5/80 (6%)
Ig 745..815 CDD:299845 3/69 (4%)
I-set 820..913 CDD:254352 19/99 (19%)
Ig 838..920 CDD:299845 22/88 (25%)
FN3 917..1033 CDD:238020 27/116 (23%)
FN3 1040..1142 CDD:238020 27/111 (24%)
fn3 1150..1237 CDD:278470 23/91 (25%)
FN3 1263..1345 CDD:238020 25/89 (28%)
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Chl1XP_038964701.1 Ig 34..125 CDD:416386 27/146 (18%)
Ig strand A 34..38 CDD:409353 2/3 (67%)
Ig strand A' 43..47 CDD:409353 0/3 (0%)
Ig strand B 52..59 CDD:409353 2/6 (33%)
Ig strand C 65..70 CDD:409353 1/4 (25%)
Ig strand C' 73..75 CDD:409353 0/1 (0%)
Ig strand D 81..84 CDD:409353 0/2 (0%)
Ig strand E 89..93 CDD:409353 2/3 (67%)
Ig strand F 104..112 CDD:409353 4/7 (57%)
Ig strand G 115..125 CDD:409353 4/57 (7%)
IgI_2_L1-CAM_like 134..224 CDD:409432 26/98 (27%)
Ig strand B 148..152 CDD:409432 1/3 (33%)
Ig strand C 162..166 CDD:409432 0/3 (0%)
Ig strand E 185..189 CDD:409432 1/3 (33%)
Ig strand F 200..205 CDD:409432 1/4 (25%)
Ig strand G 216..219 CDD:409432 0/2 (0%)
Ig 261..343 CDD:416386 22/100 (22%)
Ig strand B 273..277 CDD:409353 0/3 (0%)
Ig strand C 286..290 CDD:409353 1/3 (33%)
Ig strand E 308..312 CDD:409353 1/3 (33%)
Ig strand F 322..327 CDD:409353 2/4 (50%)
Ig strand G 335..338 CDD:409353 0/14 (0%)
Ig4_L1-NrCAM_like 347..434 CDD:409367 24/98 (24%)
Ig strand B 363..367 CDD:409367 1/3 (33%)
Ig strand C 376..380 CDD:409367 0/3 (0%)
Ig strand E 399..403 CDD:409367 0/3 (0%)
Ig strand F 413..418 CDD:409367 2/4 (50%)
Ig strand G 426..429 CDD:409367 0/2 (0%)
Ig 447..524 CDD:416386 27/174 (16%)
Ig strand A' 447..451 CDD:409353 0/3 (0%)
Ig strand B 454..463 CDD:409353 2/8 (25%)
Ig strand C 469..474 CDD:409353 2/20 (10%)
Ig strand C' 477..480 CDD:409353 0/2 (0%)
Ig strand D 485..490 CDD:409353 2/18 (11%)
Ig strand E 491..498 CDD:409353 2/12 (17%)
Ig strand F 505..513 CDD:409353 3/7 (43%)
Ig strand G 516..524 CDD:409353 3/7 (43%)
Ig 528..627 CDD:416386 27/197 (14%)
Ig strand A 528..534 CDD:409353 1/5 (20%)
Ig strand A' 537..542 CDD:409353 0/4 (0%)
Ig strand B 545..553 CDD:409353 1/7 (14%)
Ig strand C 564..568 CDD:409353 0/3 (0%)
Ig strand D 583..586 CDD:409353 0/2 (0%)
Ig strand E 589..593 CDD:409353 1/3 (33%)
Ig strand F 602..609 CDD:409353 3/6 (50%)
Ig strand G 616..620 CDD:409353 0/3 (0%)
FN3 627..716 CDD:238020 27/111 (24%)
fn3 730..811 CDD:394996 26/101 (26%)
FN3 832..926 CDD:238020 23/93 (25%)
FN3 931..1026 CDD:238020 28/103 (27%)
Bravo_FIGEY 1120..1201 CDD:404722
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.