DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and Psg26

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_001025064.1 Gene:Psg26 / 574429 MGIID:1891358 Length:475 Species:Mus musculus


Alignment Length:484 Identity:106/484 - (21%)
Similarity:165/484 - (34%) Gaps:170/484 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 SARLNVYG-PPYVRAIGPIKAVAGEDIIVHCP--------FAGY-PVEQIRWEKAHQELTTS--- 582
            :||:.:.. ||.|        |.||::::...        |..| .:..:|...|...|..|   
Mouse    33 TARVTIESLPPQV--------VEGENVLLRVDNMPENLLVFGWYRGMTNLRQAIALHSLYYSVTV 89

  Fly   583 ---NHYELASVADGGQLVIKNVEPGRDQGIYTCIVRSRAGE-EARRDMQLNVNSP---------- 633
               .|....::...|.|.|:||.. .|.|.||....|:.|| .:...:.|:|.|.          
Mouse    90 KGLKHSGRETLYINGTLWIQNVTQ-EDTGYYTFQTISKQGEMVSNTSLYLHVYSSLFICGRPTTL 153

  Fly   634 --PVIEPFKFPKNLQEGGRAQITCAVSSGDMPIYFS---WKKDDSSIPSSLQITEKKEEFYSLLV 693
              |.||  ..|.::..||...:..    .::|.|..   |.|                   .|:|
Mouse   154 VGPTIE--LVPASVAAGGSVLLLV----HNIPKYLQSLFWYK-------------------GLIV 193

  Fly   694 FKDIS-AR-------------HSGKYTCYASNAAAKVNYTAELQVRVAPRW------------RY 732
            |..:. ||             |||:.|.|::.:....|.|          |            ||
Mouse   194 FNKVEIARYRRAKKSRESGPAHSGRETVYSNGSLLLQNVT----------WKDTGFYTLRTLTRY 248

  Fly   733 EPMDTA---IMLGNTISINCE----------------AEG-------YPIP----TITWFKGQGK 767
            :.|:.|   :.:..::|:.|:                |||       :.:|    ..:|:||. .
Mouse   249 QKMEFAHIYLQVDTSLSLCCDTLDSAQLSIDPVPQHAAEGGSVLLQVHNLPEGLQAFSWYKGV-L 312

  Fly   768 GSKDFK--------------------PLSMRNHSLLLNLATDNDEGYYMCQATNEIGAGLKKTIR 812
            .::|||                    .:...|.||||...|:.|.|.|.....:.....|...::
Mouse   313 STQDFKIAEYSIATKSIIRGRAHSRREIGYTNGSLLLQDVTEKDSGLYTLITIDSNVRILTAHVQ 377

  Fly   813 IN----VNEPA-RFEQSARNISSRRNDPVTLDCHAKGDEPITIGWTQNNGRIDLNNFRFSIAEMK 872
            :|    |.:|| |...|...:.|    .|...|.:. :..|:|.|..||..:.|.. |.:::..|
Mouse   378 VNIHKLVTQPAMRVTDSTVRVQS----SVVFTCFSY-NTGISIRWLFNNQSLQLTE-RMTLSPSK 436

  Fly   873 TEKGVDSQLTIGHSDRHDSGVYRCIAENP 901
                  .||.|....:.|:|.|:|.|.||
Mouse   437 ------CQLRIHTVRKEDAGEYQCEAFNP 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165 0/1 (0%)
IGc2 553..619 CDD:197706 19/80 (24%)
I-set 634..724 CDD:254352 22/106 (21%)
ig 645..712 CDD:278476 16/83 (19%)
IG_like 734..815 CDD:214653 25/134 (19%)
Ig 745..815 CDD:299845 23/120 (19%)
I-set 820..913 CDD:254352 23/82 (28%)
Ig 838..920 CDD:299845 19/64 (30%)
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Psg26NP_001025064.1 Ig_CEACAM_D1 36..140 CDD:143251 26/112 (23%)
IG_like 45..137 CDD:214653 23/100 (23%)
Ig_CEACAM_D1 156..260 CDD:143251 27/138 (20%)
Ig_CEACAM_D1 276..378 CDD:143251 20/102 (20%)
IG_like 395..472 CDD:214653 21/77 (27%)
IGc2 400..461 CDD:197706 21/72 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.