DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and Psg23

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_064657.2 Gene:Psg23 / 56868 MGIID:1891355 Length:471 Species:Mus musculus


Alignment Length:457 Identity:102/457 - (22%)
Similarity:161/457 - (35%) Gaps:120/457 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 SARLNVYGPPYVRAIGPIKAVAGEDIIVH--------CPFAGYPVEQIRWEKA--------HQEL 579
            :|.:.:..|.:|        |.||:|::.        ..||.|. ....|...        ...:
Mouse    33 TASVTIQSPQHV--------VEGENILLQVDNLPENLLAFAWYR-GLTNWRLTIAVYLLDYSTSM 88

  Fly   580 TTSNHYELASVADGGQLVIKNVEPGRDQGIYTCIVRSRAGE-EARRDMQLNVNS----------P 633
            |...|.:...:...|.|.|:||.. .|.|.||....|..|| |:.....|.|.|          |
Mouse    89 TGPEHSDREILYSNGSLWIQNVTQ-EDTGYYTLQTISNHGELESNTSTFLQVYSSHFTCGRPSFP 152

  Fly   634 PVIEPFKFPKNLQEGGRAQITCAVSSGDMPIY---FSWKKDDSSIPSSLQITEKKE--EFYSLLV 693
            ..:.....|.::.|||    :..:...::|.|   |.|.|       .:.:..|.|  .:.:|..
Mouse   153 AKLTIESVPPSVAEGG----SVLLRVHNLPEYLQLFFWYK-------GVIMIHKVEIVRYRTLKN 206

  Fly   694 FKDISARHSGKYTCYASNAAAKVNYTAE------LQVRVAPRWRYE--------------PMDTA 738
            ..|....|||:...|::.:....|.|.:      ||. |...|:.|              |:|:|
Mouse   207 LSDPGPAHSGREIVYSNGSLLLQNVTWKDTGFYTLQT-VNRYWKMELAHIYLQVDTPCCDPLDSA 270

  Fly   739 IMLGNTISINCEAEG-------YPIP----TITWFKG-----------QGKGSKDF--------K 773
            .:..:.::.:. |||       :.:|    |.:|:||           ..|..|..        :
Mouse   271 QLRIDPVTPHA-AEGESVLLQVHNLPEDLQTFSWYKGVDSTPSFQIVEYSKAMKSIISGSAYSRR 334

  Fly   774 PLSMRNHSLLLNLATDNDEGYYMCQATNEIGAGLK-KTIRINVNEPARFEQSARNISS---RRND 834
            .:...|.||||...|:.|.|.|....   |.:.:: :|:.:.||......|....:|.   |...
Mouse   335 EIGYTNGSLLLQDVTEKDSGLYTLVT---IDSNMRVETVHVQVNIYKLVTQPVMRVSETTVRVQS 396

  Fly   835 PVTLDCHAKGDEPITIGWTQNNGRIDLNNFRFSIAEMKTEKGVDSQLTIGHSDRHDSGVYRCIAE 899
            .|...|.: .:..::|.|..|...:.|.. |.|::..|      .||.|....:.|.|.|:|.|.
Mouse   397 SVVFTCFS-DNTGVSIRWLFNKQSLQLTE-RMSLSPSK------CQLRIHTVRKEDGGEYQCEAF 453

  Fly   900 NP 901
            ||
Mouse   454 NP 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165 0/1 (0%)
IGc2 553..619 CDD:197706 19/81 (23%)
I-set 634..724 CDD:254352 20/100 (20%)
ig 645..712 CDD:278476 16/71 (23%)
IG_like 734..815 CDD:214653 24/111 (22%)
Ig 745..815 CDD:299845 21/100 (21%)
I-set 820..913 CDD:254352 22/85 (26%)
Ig 838..920 CDD:299845 18/64 (28%)
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Psg23NP_064657.2 Ig_CEACAM_D1 36..139 CDD:143251 26/112 (23%)
IG_like 39..133 CDD:214653 25/103 (24%)
Ig_CEACAM_D1 155..259 CDD:143251 24/115 (21%)
Ig_CEACAM_D1 272..374 CDD:143251 21/105 (20%)
IG_like 276..374 CDD:214653 21/101 (21%)
IG_like 388..468 CDD:214653 21/76 (28%)
IGc2 396..457 CDD:197706 19/68 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.