DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and PSG9

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:XP_016882493.1 Gene:PSG9 / 5678 HGNCID:9526 Length:495 Species:Homo sapiens


Alignment Length:426 Identity:99/426 - (23%)
Similarity:160/426 - (37%) Gaps:95/426 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   526 GSVQHSARLNVYGPPYVRAI----GPIKAVAGEDI--IVH-CP--FAGYPVEQIRWEKAHQELTT 581
            |.:..::.||.:.||....:    .|.|...|:|:  :|| .|  ..||     .|.|.  |:|.
Human    17 GLLLTASLLNFWNPPTTAEVTIEAQPPKVSEGKDVLLLVHNLPQNLPGY-----FWYKG--EMTD 74

  Fly   582 SNHYELASVADG------------------GQLVIKNVEPGRDQGIYTCIVRSRAGEEARRDMQ- 627
            ..||.::.:.||                  ..|:|:|| ..:|.|.||..:..| |:|.|.::: 
Human    75 LYHYIISYIVDGKIIIYGPAYSGRETVYSNASLLIQNV-TRKDAGTYTLHIIKR-GDETREEIRH 137

  Fly   628 ----LNVNSPPVIEPFKFPKNL--QEGGRA-QITCAVSSGDMPIYFSWKKDDSSIPSS--LQITE 683
                |.:.:|   :|:....||  :|...| ::.|...:.|..  :.|..:..|:|.:  ||:::
Human   138 FTFTLYLETP---KPYISSSNLNPREAMEAVRLICDPETLDAS--YLWWMNGQSLPVTHRLQLSK 197

  Fly   684 KKEEFYSLLVFKDISARHSGKYTCYASNAAA-------KVNYTAELQVRVAPRWRYEPMDTAIML 741
            .....|...|.|.|    :|.|.|...|..:       .:|...:|.:.........|.:..   
Human   198 TNRTLYLFGVTKYI----AGPYECEIRNPVSASRSDPVTLNLLPKLPIPYITINNLNPRENK--- 255

  Fly   742 GNTISINCEAEGYPIPTITWFKGQ----GKGSKDFKPLSMRNHSLLLNLATDNDEGYYMCQATNE 802
             :.::..||.:......|.|..||    ..|.|  :|:  .|..|:|...|.|:.|.|.|:..:.
Human   256 -DVLAFTCEPKSENYTYIWWLNGQSLPVSPGVK--RPI--ENRILILPSVTRNETGPYQCEIRDR 315

  Fly   803 IGAGLKKTIRINV---NEPARFEQSARNISSRRNDPVTLDCHAKGDEPITIGWTQNNGRIDLNNF 864
            .|......:.:||   .:..|...|.....|..|  :.|.|..:.:.|....||.|.        
Human   316 YGGLRSNPVILNVLYGPDLPRIYPSFTYYRSGEN--LDLSCFTESNPPAEYFWTING-------- 370

  Fly   865 RFSIAEMKTEKGVDSQLTIGHSDRHDSGVYRCIAEN 900
            :|..:..|        |.|....|:.||:|.|...|
Human   371 KFQQSGQK--------LFIPQITRNHSGLYACSVHN 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165 1/6 (17%)
IGc2 553..619 CDD:197706 24/88 (27%)
I-set 634..724 CDD:254352 22/101 (22%)
ig 645..712 CDD:278476 17/71 (24%)
IG_like 734..815 CDD:214653 19/84 (23%)
Ig 745..815 CDD:299845 18/73 (25%)
I-set 820..913 CDD:254352 20/81 (25%)
Ig 838..920 CDD:299845 16/63 (25%)
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
PSG9XP_016882493.1 Ig_CEACAM_D1 36..133 CDD:143251 28/105 (27%)
IG_like 45..>121 CDD:214653 21/83 (25%)
Ig 148..236 CDD:299845 21/93 (23%)
Ig 242..329 CDD:299845 20/94 (21%)
IG_like 260..322 CDD:214653 18/65 (28%)
Ig_2 335..413 CDD:290606 20/82 (24%)
IG_like 339..413 CDD:214653 19/78 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.