DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and KIRREL1

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:730 Identity:166/730 - (22%)
Similarity:264/730 - (36%) Gaps:153/730 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 HLNISHVRPDDGGLYKCVASNSMGSVQHSARLNVYGPPYVRAI--GPIKAV-AGEDIIVHC-PFA 563
            :|.|:.....|...|:|.|:.: ......|:|.|..||....|  ||:..: ||....:.| .|.
Human    84 NLEITDAELSDDASYECQATEA-ALRSRRAKLTV
LIPPEDTRIDGGPVILLQAGTPHNLTCRAFN 147

  Fly   564 GYPVEQIRW--EKAHQELTTSNHYELASVADG------GQLVIK--NVEPGRDQGIYTCIVRSRA 618
            ..|...|.|  :...||...:: .||  :.||      .||:|.  :::.||   ::||...:.|
Human   148 AKPAATIIWFRDGTQQEGAVAS-TEL--LKDGKRETTVSQLLINPTDLDIGR---VFTCRSMNEA 206

  Fly   619 ---GEEARRDMQLNVNSPPVIEPFKFPKNLQEGGRAQITCAVSSGDMPIYFSWKKDDSSIPSSLQ 680
               |:|.  .::|:|:.||.:.....|:.:|||.|...||..::....:.:.|.|....|..:.:
Human   207 IPSGKET--SIELDV
HHPPTVTLSIEPQTVQEGERVVFTCQATANPEILGYRWAKGGFLIEDAHE 269

  Fly   681 ITEKKEEFYSLLVFKDISARHSGKYTCYASNAAAKVNYTAELQVRVAPRWRYEPMDTAIMLGNTI 745
            ...:....||..         :...:|...|.....|.:..:.|..|||...:|..|...:|:.:
Human   270 SRYETNVDYSFF---------TEPVSCEVHNKVGSTNVSTLVNVH
FAPRIVVDPKPTTTDIGSDV 325

  Fly   746 SINCEAEGYPIPTITWFKGQGK------GSKDFKPLSMR----NHSLLLNLATDNDEGYYMCQA- 799
            ::.|...|.|..|:||.|....      ||.....||.:    ::.|||...|..|.|.|.|:| 
Human   326 TLTCVWVGNPPLTLTWTKKDSNMGPRPPGSPPEAALSAQVLSNSNQLLLKSVTQADAGTYTCRAI 390

  Fly   800 TNEIGAGLKKTIRINVNEPARFEQSARNISSRRNDPVTLDCH-AKGDEPITIGWTQNNGRIDLNN 863
            ...||.. ::.:.:.||.|......|...:. |.|...::|. .....|..|.|......:::..
Human   391 VPRIGVA-EREVPLYV
NGPPIISSEAVQYAV-RGDGGKVECFIGSTPPPDRIAWAWKENFLEVGT 453

  Fly   864 F-RFSIAEMKTEKGVDSQLTIGHSDRHDSGV-YRCIAENPYGRAEQIIFLAVQERPDTPSHLEIF 926
            . |:::....:..||.|.|||.:....|... |.|.|.|.:|....||.|  :||       |:.
Human   454 LERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQL--EER-------EVL 509

  Fly   927 EVG---SRTVKLSWRRPFDGNSPVLSY----LVQYQALKYLQSHGSLAAAGGDWNGHVINVSLPS 984
            .||   ..|:         |.|.:|.:    ||.:...:...|...:.....|.....:|.. |.
Human   510 PVGIIAGATI---------GASILLIFFFIALVFFLYRRRKGSRKDVTLRKLDIKVETVNRE-PL 564

  Fly   985 TSISRSYDSDLRESAIVAGLTPATTFLIRMQAINEIERSAYTEAIVLKTQEEAPTEAPSNVQVQT 1049
            |..|...|.       .|.::.||..   |:||    .|::.:.:.||......|       :.|
Human   565 TMHSDREDD-------TASVSTATRV---MKAI----YSSFKDDVDLKQDLRCDT-------IDT 608

  Fly  1050 GGESELIVTWQIPPRESWNGELIGYTVNCSEEKQNINFISVVN------------SSLKSTIVSG 1102
            ..|.|:        ::..||.   |.|...|::.:...:...:            .|.:.:..||
Human   609 REEYEM--------KDPTNGY---YNVRAHEDRPSSRAVLYADYRAPGPARFDGRPSSRLSHSSG 662

  Fly  1103 WATTKATLRG------------------------LRKYSRYAVTIRAMNSFGSGPW-SAAIFGTT 1142
            :|......||                        ...|..|       ..|.|.|: .||.:.|.
Human   663 YAQLNTYSRGPASDYGPEPTPPGPAAPAGTDTTSQLSYENY-------EKFNSHPFPGAAGYPTY 720

  Fly  1143 AEGVPEAAPQNVNCT 1157
            ..|.|:|.|..:..|
Human   721 RLGYPQAPPSGLERT 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165 6/29 (21%)
IGc2 553..619 CDD:197706 20/79 (25%)
I-set 634..724 CDD:254352 16/89 (18%)
ig 645..712 CDD:278476 12/66 (18%)
IG_like 734..815 CDD:214653 25/91 (27%)
Ig 745..815 CDD:299845 22/80 (28%)
I-set 820..913 CDD:254352 23/95 (24%)
Ig 838..920 CDD:299845 22/84 (26%)
FN3 917..1033 CDD:238020 24/122 (20%)
FN3 1040..1142 CDD:238020 21/138 (15%)
fn3 1150..1237 CDD:278470 2/8 (25%)
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 8/32 (25%)
Ig 25..116 CDD:299845 8/32 (25%)
Ig2_KIRREL3-like 138..219 CDD:143236 22/88 (25%)
I-set 223..304 CDD:254352 16/89 (18%)
Ig_2 227..305 CDD:290606 15/86 (17%)
Ig_2 311..405 CDD:290606 25/94 (27%)
IG_like 314..405 CDD:214653 25/91 (27%)
Ig5_KIRREL3 407..504 CDD:143306 24/99 (24%)
IG_like 416..504 CDD:214653 22/90 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.