DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and Psg27

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_001032245.1 Gene:Psg27 / 545925 MGIID:1891359 Length:474 Species:Mus musculus


Alignment Length:459 Identity:94/459 - (20%)
Similarity:170/459 - (37%) Gaps:119/459 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 EVYLGNSALIKC-AIPEYVRPYVRVASWHRGEE-----ILL-----------PDLSDVAGRYVVL 195
            :|..|.:.|::. .:||.:..:    ||:||.:     |.|           ||.||    ..:|
Mouse    43 QVVEGENVLLRVDNLPENLLAF----SWYRGLKNWQLAIALHLLDYNTSMTGPDHSD----REIL 99

  Fly   196 AASGDLYVRSVRSEDGLMKFSCLVTNTLNGERQRSDAVMLQV--------------KELSKNLAP 246
            .::|.|::::|..||  ..:..|.|.:.:||...:.:..|||              |...:::.|
Mouse   100 YSNGSLWIQNVTKED--TGYYTLRTISKHGELVSNTSTFLQVYSSHFTCGRPSFPAKLTIESVPP 162

  Fly   247 RTTQ--KPVMEIHVERGNDVHLPCNIQGNPFPIFTWYR------------------VSDSAALYP 291
            |..:  ...:.:|       :||..:|     :|.||:                  :||..   |
Mouse   163 RVAEGGSVFLRVH-------NLPEYLQ-----LFFWYKGVIMTNKVEIVRHRTLKNLSDPG---P 212

  Fly   292 IPSSQRVILSRTLLLIKNADERDAGKWICQASNQFGEQRI-EIRLSVNSYVS----------VHI 345
            ..|.:..:.|...||::|...:|.|.:..|..|::.:..: .|.|.|::.:|          :.|
Mouse   213 AHSGRETVFSNGSLLLQNVTWKDTGFYTLQTLNRYRKMELAHIYLQVDTSLSPCCDTLDSAQLRI 277

  Fly   346 LPQVQIVNSGGTANFNCTTTGSAIDAIDWLHNGKPLQANNALTT----------------GRDNI 394
            .|..:....|.:..|..........|..|.   |.:.:|....|                .|..|
Mouse   278 DPVTRHATEGESVLFQVYNLPKDPQAFSWY---KGVDSNPYFKTVEYSKARYSMLIGQSYSRREI 339

  Fly   395 RFLSKSSLLVQNVGRRDRGVYQCLVENQRASAQAM-AELKLGDTVPELIYTFIEQNVRPGPLISL 458
            .:|: .|||:|::..:|.|:|..:..:.....:.: .::.:...|.:.:....:..||....:..
Mouse   340 GYLN-GSLLLQDLTEKDSGLYTLITIDSNVKVETLHVQINVHKLVTQPVVRVTDSTVRVQSPVVF 403

  Fly   459 KCSASGSPPPQFAWLLDSQPIMDVSLHHRFAIGQFVDMSGDVISHLNISHVRPDDGGLYKCVASN 523
            .| .|.:......||.::|   .:.|..|.::....       ..|.|..||.:|.|.|:|.|.|
Mouse   404 TC-FSDNTGVSIRWLFNNQ---SLQLTERMSLSPSK-------CQLRIHTVRKEDAGEYQCEAFN 457

  Fly   524 SMGS 527
            ...|
Mouse   458 PANS 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352 23/111 (21%)
Ig 264..334 CDD:143165 18/88 (20%)
I-set 345..433 CDD:254352 19/104 (18%)
Ig 358..431 CDD:143165 16/89 (18%)
Ig 456..533 CDD:143165 18/72 (25%)
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Psg27NP_001032245.1 Ig_CEACAM_D1 36..139 CDD:143251 26/105 (25%)
IG_like 40..139 CDD:214653 26/105 (25%)
Ig_CEACAM_D1 155..259 CDD:143251 23/118 (19%)
Ig 275..379 CDD:299845 19/107 (18%)
IG_like 394..471 CDD:214653 20/79 (25%)
IGc2 399..460 CDD:197706 17/71 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.