Sequence 1: | NP_996226.2 | Gene: | Dscam3 / 42103 | FlyBaseID: | FBgn0261046 | Length: | 2087 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001338930.1 | Gene: | NTM / 50863 | HGNCID: | 17941 | Length: | 367 | Species: | Homo sapiens |
Alignment Length: | 357 | Identity: | 84/357 - (23%) |
---|---|---|---|
Similarity: | 139/357 - (38%) | Gaps: | 65/357 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 641 FPK-----NLQEGGRAQITCAVSSGDMPIYFSW---------KKDDSSIPSSLQITEKKEEFYSL 691
Fly 692 LVFKDISARHSGKYTCYASNAAAKVNYTAELQVRVAPRWRYEPMDTAIMLGNTISINCEAEGYPI 756
Fly 757 PTITWF----KGQGKGSKDFKPLSMRNHSLLLNLATDNDEGYYMCQATNEIGAGLKKTIRINVNE 817
Fly 818 PARFEQSARNISSRRNDPVTLDCHAKGDEPITIGWTQNNGRIDLNNFRFSIAEMKTEKGVD---- 878
Fly 879 ---SQLTIGHSDRHDSGVYRCIAENPYGRAEQIIFLAVQERPDTPSHLEIFEVGSRTVKLS-WRR 939
Fly 940 P------FDGNSP------VLSYLVQYQALKY 959 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dscam3 | NP_996226.2 | IG | 56..133 | CDD:214652 | |
Ig | 56..125 | CDD:143165 | |||
I-set | 246..337 | CDD:254352 | |||
Ig | 264..334 | CDD:143165 | |||
I-set | 345..433 | CDD:254352 | |||
Ig | 358..431 | CDD:143165 | |||
Ig | 456..533 | CDD:143165 | |||
IGc2 | 553..619 | CDD:197706 | |||
I-set | 634..724 | CDD:254352 | 15/96 (16%) | ||
ig | 645..712 | CDD:278476 | 11/75 (15%) | ||
IG_like | 734..815 | CDD:214653 | 26/84 (31%) | ||
Ig | 745..815 | CDD:299845 | 22/73 (30%) | ||
I-set | 820..913 | CDD:254352 | 22/99 (22%) | ||
Ig | 838..920 | CDD:299845 | 21/88 (24%) | ||
FN3 | 917..1033 | CDD:238020 | 15/56 (27%) | ||
FN3 | 1040..1142 | CDD:238020 | |||
fn3 | 1150..1237 | CDD:278470 | |||
FN3 | 1263..1345 | CDD:238020 | |||
Ig | 1350..1436 | CDD:299845 | |||
IG_like | 1358..1436 | CDD:214653 | |||
FN3 | 1441..1530 | CDD:238020 | |||
FN3 | 1542..1620 | CDD:238020 | |||
NTM | NP_001338930.1 | Ig | 44..132 | CDD:416386 | 12/90 (13%) |
Ig strand A' | 44..49 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 51..59 | CDD:409353 | 2/7 (29%) | ||
CDR1 | 59..63 | CDD:409353 | 0/3 (0%) | ||
FR2 | 64..70 | CDD:409353 | 1/7 (14%) | ||
Ig strand C | 64..70 | CDD:409353 | 1/7 (14%) | ||
CDR2 | 71..83 | CDD:409353 | 1/11 (9%) | ||
Ig strand C' | 72..76 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 80..83 | CDD:409353 | 1/2 (50%) | ||
FR3 | 84..118 | CDD:409353 | 6/34 (18%) | ||
Ig strand D | 87..94 | CDD:409353 | 0/6 (0%) | ||
Ig strand E | 97..103 | CDD:409353 | 2/6 (33%) | ||
Ig strand F | 110..118 | CDD:409353 | 4/7 (57%) | ||
CDR3 | 119..123 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 123..132 | CDD:409353 | 1/8 (13%) | ||
FR4 | 125..132 | CDD:409353 | 1/6 (17%) | ||
Ig_3 | 136..205 | CDD:404760 | 25/76 (33%) | ||
Ig strand A' | 142..147 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 153..160 | CDD:409353 | 3/6 (50%) | ||
Ig strand C | 166..171 | CDD:409353 | 3/4 (75%) | ||
Ig strand D | 177..180 | CDD:409353 | 1/2 (50%) | ||
Ig strand E | 184..190 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 197..204 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 211..219 | CDD:409353 | 0/7 (0%) | ||
Ig_3 | 222..299 | CDD:404760 | 19/88 (22%) | ||
putative Ig strand A | 223..229 | CDD:409353 | 0/6 (0%) | ||
Ig strand B | 239..243 | CDD:409353 | 2/3 (67%) | ||
Ig strand C | 252..256 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 278..282 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 292..297 | CDD:409353 | 2/4 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |