DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and Nrcam

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:XP_017449758.1 Gene:Nrcam / 497815 RGDID:3209 Length:1315 Species:Rattus norvegicus


Alignment Length:1426 Identity:309/1426 - (21%)
Similarity:526/1426 - (36%) Gaps:374/1426 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 LMKFSCLVTNTL-----NGERQR--SDAVMLQVKELSKNLAPRTTQKPVMEIHVERGNDVHLPCN 269
            |..|.|.:.:.|     :||:.:  .|.|.          .|..||:...:..::...::.:.|.
  Rat    19 LFLFLCQMISALDVPLDHGEKAKLLDDLVQ----------PPTITQQSPKDYIIDPRENIVIQCE 73

  Fly   270 IQGNPFPIFTWYR------VSDSAALYPIPSSQRVILSRTLLLIKNADERDAGKWICQASNQFG- 327
            .:|.|.|.|:|.|      :.....:...|.|..::::   ::.:...|...|.:.|.|.|:.| 
  Rat    74 AKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGSGTLVIN---IMSEGKAETYEGVYQCTARNERGA 135

  Fly   328 --EQRIEIRLSVNSYVSVHILPQVQIVNSGGTANFNC-TTTGSAIDAIDWLHNG-KPLQANNALT 388
              ...|.:|.|.:...:...|..: |:.||.:....| ...|.....|.|:.|. :.|..:..::
  Rat   136 AVSNNIVVRPSRSPLWTKERLEPI-ILRSGQSLVLPCRPPIGLPPAIIFWMDNSFQRLPQSERVS 199

  Fly   389 TGRDNIRFLSKSSLLVQNVGRRDRGVY------QCLVENQRASAQAMAELKLGDTV--------- 438
            .|.:...:.  |::|.::. |.|...|      |.:.:.|..|.:.::..:|.||:         
  Rat   200 QGLNGDLYF--SNVLPEDT-REDYICYARFNHTQTIQQKQPISLKVISVDELNDTIAANLSDTEF 261

  Fly   439 ------PELIYTFI--------EQNVRPGPLISLKCSASGSPPPQFAWLLDSQPI-MDVSLHHRF 488
                  .|...||:        ::.:| |.::||:|.|.|.|.|...|:.:...: ::.:.:..|
  Rat   262 YGAKSSKERPPTFLTPEGNESHKEELR-GNVLSLECIAEGLPTPVIYWIKEDGTLPVNRTFYRNF 325

  Fly   489 AIGQFVDMSGDVISHLNISHVRPDDGGLYKCVASNSMGSVQHSARLNVYGPPYVRAIGPIKAVAG 553
            .            ..|.|.||...|.|.|:|:|.|::|:|.|:..:.|...||            
  Rat   326 K------------KTLQIIHVSEADSGNYQCIAKNALGAVHHTISVTVKAAPY------------ 366

  Fly   554 EDIIVHCPFAGYPVEQIRWEKAHQELTTSNHYELASVADGGQLVIKNVEPGRDQGIYTCIVRSRA 618
                              |..|...|..|                    || :.|...|      
  Rat   367 ------------------WIVAPHNLVLS--------------------PG-ENGTLIC------ 386

  Fly   619 GEEARRDMQLNVNSPPVIEPFKFPKNLQEGGRAQITCAVSSGDMPIYFSWKKDDSSIPSSLQITE 683
                    :.|.|..|.|                              ||..:...:..:|....
  Rat   387 --------RANGNPKPRI------------------------------SWLTNGVPVEIALDDPS 413

  Fly   684 KKEEFYSLLVFKDISARHSGKYTCYASN------AAAKVNYTAE-LQVRVAPRWRYEPMDTAIML 741
            :|.: ...::|.::....|..|.|.|||      |.|.||..|| .::..:....|:     ::.
  Rat   414 RKID-GDTIMFSNVQESSSAVYQCNASNKYGYLLANAFVNVLAEPPRILTSANTLYQ-----VIA 472

  Fly   742 GNTISINCEAEGYPIPTITWFKGQGKGS---KDFKPLSMRNHSLLLNLATDNDEGYYMCQATNEI 803
            .....::|...|.|:|||.||||. |||   :|...|. .|.:|.:.:|..:..|.|.|.|.|::
  Rat   473 NRPALLDCAFFGSPMPTIEWFKGT-KGSALHEDIYVLH-DNGTLEIPVAQKDSTGTYTCVARNKL 535

  Fly   804 GAGLKKTIRINVNEPARFEQSARNISSRRNDPVTLDCHAKGDEPI--TIGWTQNNGRIDLNNFRF 866
            |.. |..:.:.:.:|.||.:.......:|...|:.:|..|.|..:  ||.|.::||.:. |:.||
  Rat   536 GMA-KNEVHLEIKDPTRFIKQPEYAVVQRGSKVSFECKVKHDHTLIPTILWLKDNGELP-NDERF 598

  Fly   867 SIAEMKTEKGVDSQLTIGHSDRHDSGVYRCIAENPYGRAEQIIFLAV----------QERPDTPS 921
            |:.:        ..|.:......|.|.|.|.|............|.|          .:.|:.|.
  Rat   599 SVDK--------DHLVVSDVKDEDGGTYTCAANTTLDSVSASAVLRVVAPTPTPAPIYDVPNPPF 655

  Fly   922 HLEIFEVGSRTVKLSWRRPFDGNSPVLSYLVQYQALKYLQSHGSLAAAGGDWNGHVINVSLPSTS 986
            .||:.....::|:|:|....|.|||:..::::|:...:         ..|.|. |...||...|:
  Rat   656 DLELTNQLDKSVQLTWTPGDDNNSPITKFIIEYEDAMH---------EAGLWR-HQAEVSGTQTT 710

  Fly   987 ISRSYDSDLRESAIVAGLTPATTFLIRMQAINEIERSAYTEA---IVLKTQEEAPTEAPSNVQVQ 1048
                  :.|:       |:|...:..|:.|.|.|.||..:||   .:.|..|  |.:.|:.|:..
  Rat   711 ------AQLK-------LSPYVNYSFRVMAENSIGRSVPSEASEQYLTKAAE--PDQNPTAVEGL 760

  Fly  1049 TGGESELIVTWQIPPRESW--NGELIGYTVNCSEEKQNINFISVVNSSLKSTIVSGWATTKATLR 1111
            ......|::||:  |...:  ||..:.|.|:..::..:..:.|||.:::...||||..|      
  Rat   761 GTEPDNLVITWK--PLNGFQSNGPGLQYKVSWRQKDGDDEWTSVVVANVSKYIVSGTPT------ 817

  Fly  1112 GLRKYSRYAVTIRAMNSFGSGPWSAAIFGTTAEGVPEAAPQNVNCTALSSQSLKISWLEPPLQFH 1176
                :..|.:.::|:|..|..|..||:.|.:.|.:|..||.||..:.::|...:..|...|.:..
  Rat   818 ----FVPYLIKVQALNDVGFAPEPAAVMGHSGEDLPMVAPGNVRVSVVNSTLAEAHWDPVPPKSV 878

  Fly  1177 GGIIQGYKILYRPIVHQIDFPAKLEIKRT-------------SNLETYLHTLHKASNYSIRVLAY 1228
            .|.:|||:|.|        :.|:...||.             |.....|..|...|:|.:.|...
  Rat   879 RGHLQGYRIYY--------WKAQSSSKRNRRHIEKKILTFQGSKTHGMLPGLQPYSHYVLNVRVV 935

  Fly  1229 TATGDGLASHPLFCQTDDDVPDAPAAIKAAALTADSILISWLTPKNRNGIISHYTVYSREAGRKG 1293
            ...|:|.||......|.:.||.||:::|....|.||:.:.|..|.:.|||::.|.:..:...   
  Rat   936 NGKGEGPASADRGFHTPEGVPSAPSSLKIVNPTLDSLTLEWDPPSHPNGILTEYILKYQPIN--- 997

  Fly  1294 QAKTH----MVRVDENGYPVTFESRSLAENQMYEFWVSASTSVGEGEPTSVIAQATNTRAPARIA 1354
              .||    :|.:........:..::|..:..|:|:..|.||||.|  :.:..:|..|....:.|
  Rat   998 --STHELGPLVDLKIPANKTRWTLKNLNFSTRYKFYFYAQTSVGSG--SQITEEAITTVDEGKKA 1058

  Fly  1355 SFGQVVRKAVGTGLVLECLAVGNPTPRARWLTRDRPVTFSPFYEVTNEGNLKIHRVEGSLSGNYT 1419
            .   ::...||.|.|   .||   :||.                                 ||.|
  Rat  1059 G---ILPPDVGAGKV---RAV---SPRI---------------------------------GNVT 1081

  Fly  1420 CTANNLFGSDEIQYQVIAMKPPSAPQIIVQYASADSIRVSWDAPDDGGAPLQGYTISYHTAG--E 1482
            ..|...:.:                             :||:.  :|...::.| :.|..||  |
  Rat  1082 AAAAETYAN-----------------------------ISWEY--EGPEHVKFY-VEYGVAGSKE 1114

  Fly  1483 SWSITELLPENNAFTISGLKCGNQYIIKMSAHN-----------MVGSGVASEEINVWTKG 1532
            .|....:....:.|.:.||..|..|.:::.|..           ..|..:||.::::.|:|
  Rat  1115 EWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAEGDSGFVSSEDVFETGPAMASRQVDIATQG 1175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352 20/99 (20%)
Ig 264..334 CDD:143165 16/78 (21%)
I-set 345..433 CDD:254352 19/95 (20%)
Ig 358..431 CDD:143165 15/80 (19%)
Ig 456..533 CDD:143165 22/77 (29%)
IGc2 553..619 CDD:197706 8/65 (12%)
I-set 634..724 CDD:254352 19/96 (20%)
ig 645..712 CDD:278476 11/72 (15%)
IG_like 734..815 CDD:214653 25/83 (30%)
Ig 745..815 CDD:299845 25/72 (35%)
I-set 820..913 CDD:254352 23/94 (24%)
Ig 838..920 CDD:299845 21/93 (23%)
FN3 917..1033 CDD:238020 29/118 (25%)
FN3 1040..1142 CDD:238020 26/103 (25%)
fn3 1150..1237 CDD:278470 24/99 (24%)
FN3 1263..1345 CDD:238020 20/85 (24%)
Ig 1350..1436 CDD:299845 13/85 (15%)
IG_like 1358..1436 CDD:214653 12/77 (16%)
FN3 1441..1530 CDD:238020 18/101 (18%)
FN3 1542..1620 CDD:238020
NrcamXP_017449758.1 IgI_NrCAM 50..144 CDD:409458 19/96 (20%)
Ig strand B 68..72 CDD:409458 0/3 (0%)
Ig strand C 81..85 CDD:409458 1/3 (33%)
Ig strand E 106..110 CDD:409458 0/3 (0%)
Ig strand F 124..129 CDD:409458 1/4 (25%)
Ig strand G 138..141 CDD:409458 0/2 (0%)
Ig 153..242 CDD:416386 19/92 (21%)
Ig strand A 153..156 CDD:409353 0/2 (0%)
Ig strand A' 158..162 CDD:409353 1/4 (25%)
Ig strand B 165..173 CDD:409353 1/7 (14%)
Ig strand C 180..186 CDD:409353 2/5 (40%)
Ig strand C' 189..192 CDD:409353 0/2 (0%)
Ig strand D 198..202 CDD:409353 0/3 (0%)
Ig strand E 204..208 CDD:409353 0/3 (0%)
Ig strand F 219..227 CDD:409353 2/7 (29%)
Ig strand G 230..242 CDD:409353 3/11 (27%)
Ig 281..362 CDD:416386 24/93 (26%)
Ig strand B 292..296 CDD:409353 2/3 (67%)
Ig strand C 305..309 CDD:409353 0/3 (0%)
Ig strand E 327..331 CDD:409353 1/3 (33%)
Ig strand F 341..346 CDD:409353 2/4 (50%)
Ig strand G 354..357 CDD:409353 1/2 (50%)
Ig 366..454 CDD:416386 28/183 (15%)
Ig strand B 382..386 CDD:409353 1/3 (33%)
Ig strand C 395..399 CDD:409353 2/33 (6%)
Ig strand E 419..423 CDD:409353 0/3 (0%)
Ig strand F 433..438 CDD:409353 2/4 (50%)
Ig strand G 446..449 CDD:409353 1/2 (50%)
Ig 460..546 CDD:416386 26/93 (28%)
Ig strand A 460..463 CDD:409353 0/2 (0%)
Ig strand A' 467..470 CDD:409353 1/7 (14%)
Ig strand B 476..483 CDD:409353 1/6 (17%)
Ig strand C 489..494 CDD:409353 3/4 (75%)
Ig strand C' 496..498 CDD:409353 0/2 (0%)
Ig strand D 505..509 CDD:409353 0/3 (0%)
Ig strand E 512..517 CDD:409353 1/4 (25%)
Ig strand F 525..533 CDD:409353 4/7 (57%)
Ig strand G 536..546 CDD:409353 2/10 (20%)
Ig 553..637 CDD:416386 21/92 (23%)
Ig strand A 553..556 CDD:409353 0/2 (0%)
Ig strand A' 558..562 CDD:409353 0/3 (0%)
Ig strand B 565..574 CDD:409353 2/8 (25%)
Ig strand C 582..587 CDD:409353 3/4 (75%)
Ig strand C' 590..593 CDD:409353 1/2 (50%)
Ig strand D 597..602 CDD:409353 3/4 (75%)
Ig strand E 603..609 CDD:409353 1/5 (20%)
Ig strand F 616..624 CDD:409353 4/7 (57%)
Ig strand G 627..637 CDD:409353 1/9 (11%)
FN3 651..741 CDD:238020 29/112 (26%)
fn3 754..836 CDD:394996 22/93 (24%)
fn3 852..944 CDD:394996 24/99 (24%)
fn3 957..1041 CDD:394996 23/88 (26%)
fn3 1075..1143 CDD:394996 20/132 (15%)
Bravo_FIGEY 1198..1287 CDD:404722
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.