Sequence 1: | NP_996226.2 | Gene: | Dscam3 / 42103 | FlyBaseID: | FBgn0261046 | Length: | 2087 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001306032.1 | Gene: | OPCML / 4978 | HGNCID: | 8143 | Length: | 354 | Species: | Homo sapiens |
Alignment Length: | 340 | Identity: | 81/340 - (23%) |
---|---|---|---|
Similarity: | 124/340 - (36%) | Gaps: | 61/340 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 352 VNSGGTANFNCTTTGSAIDAIDWLHNGKPLQANNALTTGRDNIRFL----SKSSLLVQNVGRRDR 412
Fly 413 GVYQCLVENQRASAQAMAELKLGDTVPELIYTFIEQNVRPGPLISLKCSASGSPPPQFAWLLDSQ 477
Fly 478 PIMDVSLHHRFAIGQ-FVDMSGDVISHLNISHVRPDDGGLYKCVASNSMGSVQ-HSARLNVYGPP 540
Fly 541 YVRAIGPIKAVAGEDIIVHCPFAGYPVEQIRWEKAHQELTTSNHYELASVADG---------GQL 596
Fly 597 VIKNVEPGRDQGIYTCIVRSRAGEEARRDMQLNVN----------SPPVIEPFKFPKNLQEGGRA 651
Fly 652 QITCAVSSGDMPIYF 666 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dscam3 | NP_996226.2 | IG | 56..133 | CDD:214652 | |
Ig | 56..125 | CDD:143165 | |||
I-set | 246..337 | CDD:254352 | |||
Ig | 264..334 | CDD:143165 | |||
I-set | 345..433 | CDD:254352 | 20/84 (24%) | ||
Ig | 358..431 | CDD:143165 | 18/76 (24%) | ||
Ig | 456..533 | CDD:143165 | 23/78 (29%) | ||
IGc2 | 553..619 | CDD:197706 | 18/74 (24%) | ||
I-set | 634..724 | CDD:254352 | 8/33 (24%) | ||
ig | 645..712 | CDD:278476 | 6/22 (27%) | ||
IG_like | 734..815 | CDD:214653 | |||
Ig | 745..815 | CDD:299845 | |||
I-set | 820..913 | CDD:254352 | |||
Ig | 838..920 | CDD:299845 | |||
FN3 | 917..1033 | CDD:238020 | |||
FN3 | 1040..1142 | CDD:238020 | |||
fn3 | 1150..1237 | CDD:278470 | |||
FN3 | 1263..1345 | CDD:238020 | |||
Ig | 1350..1436 | CDD:299845 | |||
IG_like | 1358..1436 | CDD:214653 | |||
FN3 | 1441..1530 | CDD:238020 | |||
FN3 | 1542..1620 | CDD:238020 | |||
OPCML | NP_001306032.1 | Ig | 44..132 | CDD:416386 | 21/86 (24%) |
Ig strand A' | 44..49 | CDD:409353 | 1/1 (100%) | ||
Ig strand B | 51..59 | CDD:409353 | 2/8 (25%) | ||
CDR1 | 59..63 | CDD:409353 | 0/3 (0%) | ||
FR2 | 64..70 | CDD:409353 | 1/5 (20%) | ||
Ig strand C | 64..70 | CDD:409353 | 1/5 (20%) | ||
CDR2 | 71..83 | CDD:409353 | 3/11 (27%) | ||
Ig strand C' | 72..76 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
FR3 | 84..118 | CDD:409353 | 9/33 (27%) | ||
Ig strand D | 87..94 | CDD:409353 | 1/6 (17%) | ||
Ig strand E | 97..103 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 119..123 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 123..132 | CDD:409353 | 1/9 (11%) | ||
FR4 | 125..132 | CDD:409353 | 1/7 (14%) | ||
Ig_3 | 135..206 | CDD:404760 | 25/85 (29%) | ||
Ig strand A | 135..138 | CDD:409353 | 1/2 (50%) | ||
Ig strand A' | 144..148 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 151..160 | CDD:409353 | 2/8 (25%) | ||
Ig strand C | 165..170 | CDD:409353 | 2/15 (13%) | ||
Ig strand C' | 171..174 | CDD:409353 | 1/2 (50%) | ||
Ig strand F | 198..206 | CDD:409353 | 4/7 (57%) | ||
Ig | 224..312 | CDD:416386 | 23/105 (22%) | ||
putative Ig strand A | 224..230 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 240..244 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 253..257 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 279..283 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 293..298 | CDD:409353 | 3/4 (75%) | ||
Ig strand G | 306..309 | CDD:409353 | 1/2 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |