DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and OPCML

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens


Alignment Length:340 Identity:81/340 - (23%)
Similarity:124/340 - (36%) Gaps:61/340 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 VNSGGTANFNCTTTGSAIDAIDWLHNGKPLQANNALTTGRDNIRFL----SKSSLLVQNVGRRDR 412
            |..|.:|...| |....:..:.||:....|.|.|...:....:..|    ::.|:::|||...|.
Human    47 VRQGESATLRC-TIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDE 110

  Fly   413 GVYQCLVENQRASAQAMAELKLGDTVPELIYTFIEQNVRPGPLISLKCSASGSPPPQFAWLLDSQ 477
            |.|.|.|:.......:...| :....|:::....:..|..|..::|.|.|.|.|.|...|     
Human   111 GPYTCSVQTDNHPKTSRVHL-IV
QVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTW----- 169

  Fly   478 PIMDVSLHHRFAIGQ-FVDMSGDVISHLNISHVRPDDGGLYKCVASNSMGSVQ-HSARLNVYGPP 540
                  .|.....|| ||  |.|  .:|.||.::.|..|.|:|.|.|.:.:.. ...::.|..||
Human   170 ------RHLSVKEGQGFV--SED--EYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPP 224

  Fly   541 YVRAIGPIKAVAGEDIIVHCPFAGYPVEQIRWEKAHQELTTSNHYELASVADG---------GQL 596
            |:..........|:..|:.|..:..|:.:.:|.|....|.|.        .||         ..|
Human   225 YISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATG--------LDGMRIENKGRMSTL 281

  Fly   597 VIKNVEPGRDQGIYTCIVRSRAGEEARRDMQLNVN----------SPPVIEPFKFPKNLQEGGRA 651
            ...||.. :|.|.|||:..::.|         |.|          |..|..|......:....||
Human   282 TFFNVSE-KDYGNYTCVATNKLG---------NTNASITLYEISPSSAVAGPGAVIDGVNSASRA 336

  Fly   652 QITCAVSSGDMPIYF 666
             :.|...||.:..:|
Human   337 -LACLWLSGTLLAHF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352 20/84 (24%)
Ig 358..431 CDD:143165 18/76 (24%)
Ig 456..533 CDD:143165 23/78 (29%)
IGc2 553..619 CDD:197706 18/74 (24%)
I-set 634..724 CDD:254352 8/33 (24%)
ig 645..712 CDD:278476 6/22 (27%)
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
OPCMLNP_001306032.1 Ig 44..132 CDD:416386 21/86 (24%)
Ig strand A' 44..49 CDD:409353 1/1 (100%)
Ig strand B 51..59 CDD:409353 2/8 (25%)
CDR1 59..63 CDD:409353 0/3 (0%)
FR2 64..70 CDD:409353 1/5 (20%)
Ig strand C 64..70 CDD:409353 1/5 (20%)
CDR2 71..83 CDD:409353 3/11 (27%)
Ig strand C' 72..76 CDD:409353 0/3 (0%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 9/33 (27%)
Ig strand D 87..94 CDD:409353 1/6 (17%)
Ig strand E 97..103 CDD:409353 1/5 (20%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 0/3 (0%)
Ig strand G 123..132 CDD:409353 1/9 (11%)
FR4 125..132 CDD:409353 1/7 (14%)
Ig_3 135..206 CDD:404760 25/85 (29%)
Ig strand A 135..138 CDD:409353 1/2 (50%)
Ig strand A' 144..148 CDD:409353 0/3 (0%)
Ig strand B 151..160 CDD:409353 2/8 (25%)
Ig strand C 165..170 CDD:409353 2/15 (13%)
Ig strand C' 171..174 CDD:409353 1/2 (50%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig 224..312 CDD:416386 23/105 (22%)
putative Ig strand A 224..230 CDD:409353 2/5 (40%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 3/4 (75%)
Ig strand G 306..309 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.