DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and CG7166

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:474 Identity:102/474 - (21%)
Similarity:176/474 - (37%) Gaps:137/474 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   631 NSPPVIEPFKFPK-----NLQEGGRAQITCAVSS-GDMPIYFSWKKDDSSIPSS-LQITEKKEEF 688
            |.||...| ||..     .:..|...::.|.|.: |...:.  |:|..|.:.:. |:|| :.:.|
  Fly    32 NDPPTTAP-KFLSRGHLYKVIVGETIELPCKVQNLGSFVLL--WRKGSSVLTAGHLKIT-RDQRF 92

  Fly   689 -----YSLLVFKDISARHSGKYTCYASNAAAKVNYTAELQVRVAPRWRYEPMDTAIML--GNTIS 746
                 |:|.: ..:..:.:|.|.|...:...: :....:::.|.|..|..|.:..:..  |:|::
  Fly    93 KIVGDYNLQI-NGVKTQDAGDYICQLGDQENR-DQVHTVEILVPPTLRALPHNGQVTARKGSTVT 155

  Fly   747 INCEAEGYPIPTITWFKGQGKGSKDF--KPLSMRNHS-LLLNLATDNDEGYYMCQATNEIGAGLK 808
            :.|:|.|.|:|||.|||      ||.  .|..:.:.| |:|.....:..|.|.|.|.|.:...:.
  Fly   156 LECKASGNPVPTIFWFK------KDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADNGVKDRVS 214

  Fly   809 KTIRINVNEPARFEQSARNISSRRNDPVTLDCHAKGDEPITIGWTQNNGRIDLNNFRFSIAEMKT 873
            ..|::.:..|.........:.:.....|.|.|...||....:.|.||:..:|             
  Fly   215 MDIQLTILSPPEITVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLD------------- 266

  Fly   874 EKGVDSQLTIGHSDRH----------DSGVYRCIAENPYGRAEQIIFLAVQERPD-----TPSHL 923
              ..|.:......||:          |.|.|.|:|:|..||.::  ::.|..||.     :|:..
  Fly   267 --ATDRRSMYPRDDRYSLIIRNFQPTDFGNYSCVADNALGRTKK--YIEVSGRPGPADFISPALS 327

  Fly   924 EIFEVGSRT-----------VKLSWRR---------------------PF--DGNSPVLSYLVQ- 953
            ...:..:.|           :||.:||                     |.  ||:..::||||: 
  Fly   328 GFLDHYNLTWTIESIPPLDEIKLLYRRLLMNETYQHPGKWHEYHIKPTPIRTDGSHFLMSYLVKN 392

  Fly   954 ------YQAL-----KYLQSHGSLAAAGGDWNGHVINVSLPSTSISRSYD--------------S 993
                  |:|:     ||            .||    .:|......:|::|              |
  Fly   393 LEHNAVYEAIVQAKNKY------------GWN----EISDIHQFYTRNHDLLLDIDMEYKMGISS 441

  Fly   994 DLRESAIVAGLTPATTFLI 1012
            ::|.|..|:|:..:...|:
  Fly   442 NIRISPTVSGIILSAFILV 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352 20/101 (20%)
ig 645..712 CDD:278476 16/73 (22%)
IG_like 734..815 CDD:214653 25/85 (29%)
Ig 745..815 CDD:299845 22/72 (31%)
I-set 820..913 CDD:254352 20/102 (20%)
Ig 838..920 CDD:299845 22/96 (23%)
FN3 917..1033 CDD:238020 29/161 (18%)
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 16/87 (18%)
Ig 56..116 CDD:143165 14/63 (22%)
IG_like 144..221 CDD:214653 24/82 (29%)
IGc2 151..209 CDD:197706 23/63 (37%)
IG_like 232..313 CDD:214653 20/97 (21%)
Ig 242..311 CDD:143165 20/85 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.