DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and dpr13

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:347 Identity:76/347 - (21%)
Similarity:120/347 - (34%) Gaps:97/347 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 YVRSVRSEDGLMKFSCLVTNTLNGERQRSDAVMLQVKELSKNLAPRTTQKPVMEIHVERGNDVHL 266
            |.:|..|..|....|...||.::|:.|.:               |...|:.|::.|..       
  Fly    89 YAQSAASAGGSSITSFDSTNVIDGQSQPT---------------PTHLQEAVLQTHSH------- 131

  Fly   267 PCNIQGNPFPIFTWYRVSDSAALYPIPSSQRVILSRTLLLIKNADERDAGKWICQASNQFGEQRI 331
             ..||           ..|:|..||||..:...:...|                :|:|.. |..:
  Fly   132 -SRIQ-----------AKDTAGPYPIPVHRPEPVENHL----------------EANNGI-EGGM 167

  Fly   332 EIRLSVNSYV----SVHILPQVQIVNSGGTANFNCTTTGSAIDAIDWLHNGKPLQANNALTTGRD 392
            |.......|.    |..:..|:     |.||:..||........:.|:...........|||...
  Fly   168 ESLFGTPMYFGTENSTVVTTQI-----GATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSS 227

  Fly   393 NIRF----LSKS---SLLVQNVGRRDRGVYQCLVENQRASA--------QAMAELKLGDTVPELI 442
            :.||    |..|   :|.::.|..||.|||:|.|.....::        :|.||:    |.|.:.
  Fly   228 DERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEI----TGPPIR 288

  Fly   443 YTFIEQNVRPGPLISLKCSA--SGSPPPQFAWLLDSQPIMDVSLHHRFAIGQFVDMSGD---VIS 502
            |      :.||..:.|:|..  :........|..|::.|       .:.|.:.:::|.:   ..|
  Fly   289 Y------LTPGSTLRLQCRVVQNTEASEYIFWYHDNRMI-------NYDIDRGINVSTEPDFQSS 340

  Fly   503 HLNISHVRPDDGGLYKCVASNS 524
            .|.|...|.:..|.:.|||||:
  Fly   341 ELTIQRTRREHSGNFTCVASNT 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352 17/90 (19%)
Ig 264..334 CDD:143165 13/69 (19%)
I-set 345..433 CDD:254352 26/102 (25%)
Ig 358..431 CDD:143165 21/87 (24%)
Ig 456..533 CDD:143165 17/74 (23%)
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
dpr13NP_001033956.2 V-set 180..276 CDD:284989 24/100 (24%)
IG_like 182..262 CDD:214653 23/84 (27%)
IG_like 285..362 CDD:214653 20/89 (22%)
IGc2 292..361 CDD:197706 17/75 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.