Sequence 1: | NP_996226.2 | Gene: | Dscam3 / 42103 | FlyBaseID: | FBgn0261046 | Length: | 2087 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286719.1 | Gene: | babos / 37557 | FlyBaseID: | FBgn0034724 | Length: | 196 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 39/204 - (19%) |
---|---|---|---|
Similarity: | 83/204 - (40%) | Gaps: | 35/204 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 179 EILLPDLSDVAGRYVVLAASGDLYVRSVRSEDGLM---KFSCLVTNTLNGERQRSDAVMLQVKEL 240
Fly 241 SKNLAPRTTQK--PVMEIHVERGNDVHLPCNIQGNPFP---IFTWY----RVSDSAALYPIPSSQ 296
Fly 297 RVILSRTLLLIKNADERDAGKWICQASNQFGEQRIEIRLSVNSYVSVHILPQVQIVNSGGTANF- 360
Fly 361 NCTTTGSAI 369 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dscam3 | NP_996226.2 | IG | 56..133 | CDD:214652 | |
Ig | 56..125 | CDD:143165 | |||
I-set | 246..337 | CDD:254352 | 19/99 (19%) | ||
Ig | 264..334 | CDD:143165 | 14/76 (18%) | ||
I-set | 345..433 | CDD:254352 | 7/26 (27%) | ||
Ig | 358..431 | CDD:143165 | 4/13 (31%) | ||
Ig | 456..533 | CDD:143165 | |||
IGc2 | 553..619 | CDD:197706 | |||
I-set | 634..724 | CDD:254352 | |||
ig | 645..712 | CDD:278476 | |||
IG_like | 734..815 | CDD:214653 | |||
Ig | 745..815 | CDD:299845 | |||
I-set | 820..913 | CDD:254352 | |||
Ig | 838..920 | CDD:299845 | |||
FN3 | 917..1033 | CDD:238020 | |||
FN3 | 1040..1142 | CDD:238020 | |||
fn3 | 1150..1237 | CDD:278470 | |||
FN3 | 1263..1345 | CDD:238020 | |||
Ig | 1350..1436 | CDD:299845 | |||
IG_like | 1358..1436 | CDD:214653 | |||
FN3 | 1441..1530 | CDD:238020 | |||
FN3 | 1542..1620 | CDD:238020 | |||
babos | NP_001286719.1 | ig | 70..154 | CDD:278476 | 17/86 (20%) |
IG_like | 70..154 | CDD:214653 | 17/86 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |