DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and CG13506

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:382 Identity:75/382 - (19%)
Similarity:145/382 - (37%) Gaps:98/382 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 PPYVRAIG-PIKAVAGEDIIVHCPFAGYPVEQ-IRWEKAHQELTTSNHYELASVADGGQ------ 595
            |||..... .::|..|:|:|::|....:.:.. :.|.|        |...:|:    ||      
  Fly    69 PPYFDVTDLRVEAKPGDDVILNCDARNFQLSNAVVWYK--------NRIIIAN----GQNPISQR 121

  Fly   596 --------LVIKNVEPGRDQGIYTCIV---RSRAGEEARRDMQLNV--NSPPVIEPFKFPKNLQE 647
                    ::::||.| .|...|.|.:   |.|.....|...:|::  :...:.:.   .:..::
  Fly   122 VQCMLNNSILLRNVSP-EDSDDYYCEILPQRVRQHTALRVGARLSILCDDRDITDR---SQTFRQ 182

  Fly   648 GGRAQITCAVSSGDMPIYFSWKKDD-SSIPSSLQITEKKEEFYSLLVFKDISARHSGKYTCYASN 711
            |...::.|.....|... ..|..:| :..|||:      :....:::..::..:::|.|.|.|.:
  Fly   183 GDHHKLECRTYLPDNAT-IKWSFNDLNGQPSSV------DNQNGVIILDNVDEKNAGDYQCLADD 240

  Fly   712 AAAKVNY-TAELQVRVAPRWRYEPMDTAIMLGNTISINCEAEGYPIPTITWFKGQGKGSKDFKPL 775
            .:....: |..:.|:.:|.......:.....|.|..:.|.....||       |:....||.|.|
  Fly   241 GSRHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPI-------GRSYFIKDGKTL 298

  Fly   776 SM-----------RNH---SLLLNLATDNDEGYYMCQATNEIGAGLKKTIRINVN-EPARFEQSA 825
            .:           .:|   :|::...||:|.|.|:||..|.||:...| :.::.| |..:||   
  Fly   299 QLSDKYSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIGSNEVK-VHVSYNPETPQFE--- 359

  Fly   826 RNISSRRNDPVTLDCHAKGDEPITIGWTQNNGRIDLNNFRFSIAEMKTEKGVDSQLT 882
                         |...:|:: :|:.|...:            .::.:|..:|.|||
  Fly   360 -------------DMTVEGNK-VTLHWLVRS------------HQLLSEAMLDYQLT 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706 18/83 (22%)
I-set 634..724 CDD:254352 13/91 (14%)
ig 645..712 CDD:278476 12/67 (18%)
IG_like 734..815 CDD:214653 23/94 (24%)
Ig 745..815 CDD:299845 21/83 (25%)
I-set 820..913 CDD:254352 11/63 (17%)
Ig 838..920 CDD:299845 9/45 (20%)
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 16/79 (20%)
IGc2 83..146 CDD:197706 15/75 (20%)
IG_like 176..254 CDD:214653 13/87 (15%)
Ig 176..239 CDD:299845 11/72 (15%)
I-set 258..349 CDD:254352 24/98 (24%)
Ig 275..348 CDD:143165 21/80 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.