DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and wrapper

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:521 Identity:104/521 - (19%)
Similarity:193/521 - (37%) Gaps:140/521 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   609 IYTCIVRSRAGEEARRDMQLNVNSPPVIEPFK-FPKNLQ--EGGRAQITCAVSSGDMPI-YFSWK 669
            :..|::.:....:.:.::..| |.....:.|| .|..::  |....|:.|.:::   |. |..|.
  Fly     8 VVRCLLAALILGQVQAELDFN-NDLENSQKFKSIPTTVKTYENDTVQLPCTLNT---PFRYVRWH 68

  Fly   670 KDDSSI-----------------PS-SLQITEKKEEFYSLLVFKDISARHSGKYTCYASNAAAKV 716
            :||.::                 |: |||:.             ::.:..:|.|.|..::.:..|
  Fly    69 RDDVALVDSRHPELPPPDRIMLWPNGSLQVA-------------NVQSSDTGDYYCEMNSDSGHV 120

  Fly   717 NYTAELQVRVAPRWRYEPMD-TAIMLGNTISINCEAEGYPIPTITWFKGQGKGSKDFKPLSM--R 778
            .....::|::||:...||.| |...:|....:.|||:|.|.|.|||    .......:|.|.  .
  Fly   121 VQQHAIEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITW----RLNGNVIQPQSNTGN 181

  Fly   779 NHSLLLNLATDNDEGYYMCQATNEIGAGLKKTI--------RINVNEPARFEQSARNISSRRNDP 835
            ..||:|.:.:.|..|...|.|:|.:|......:        .:::.:|..:.:    :.||.:  
  Fly   182 RQSLILEIKSRNQAGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTK----LGSRAH-- 240

  Fly   836 VTLDCHAKGDEPITIGWTQNNGRIDLN-NFRFSIAEMKTEKGVDSQLTIGHSDRH---------- 889
              |:|..:.....|:.|..:...:.|. :.....:|::|.:.||..:   ::.||          
  Fly   241 --LECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQTNRSVDHYV---NAVRHMLVVKSVRNA 300

  Fly   890 DSGVYRCIAENPY----------GRAEQIIFLAVQERPDTPSHLEIFEVGSRTVKLSWRRPFDGN 944
            |.|.|.|.|.|..          ||....:|........:.||:.:::..|..            
  Fly   301 DMGQYECRASNQISVKSGSVELTGRPMPCLFKINPGTQSSTSHVLVWQTESLL------------ 353

  Fly   945 SPVLSYLVQYQALKYLQSHGSLAAAGGDWNGHVINVSLPSTSISRSYDSDLRESAIVA----GLT 1005
             |::.:     .||:.|                    :||.:::|...::..|..|.|    ||.
  Fly   354 -PIMEF-----KLKFRQ--------------------IPSNNVTRQVRTNWTELTIPAQATNGLI 392

  Fly  1006 PATTFLIRMQAINEIERSAYTEAIVLKTQEEAPTEAPSNVQVQTGGESELIVTWQIPPRESWNGE 1070
            ..||:     .::.::.::..|..||.......::....|:..||||.||       |..|...|
  Fly   393 YITTY-----TLHGLQPASLYEVSVLARNSFGWSDNSKIVRFATGGEVEL-------PNYSTESE 445

  Fly  1071 L 1071
            |
  Fly   446 L 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706 1/9 (11%)
I-set 634..724 CDD:254352 19/111 (17%)
ig 645..712 CDD:278476 15/87 (17%)
IG_like 734..815 CDD:214653 24/91 (26%)
Ig 745..815 CDD:299845 20/79 (25%)
I-set 820..913 CDD:254352 22/113 (19%)
Ig 838..920 CDD:299845 20/102 (20%)
FN3 917..1033 CDD:238020 20/119 (17%)
FN3 1040..1142 CDD:238020 11/32 (34%)
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
wrapperNP_477404.1 Ig 41..124 CDD:299845 17/98 (17%)
IG_like 41..118 CDD:214653 16/92 (17%)
IG_like 145..218 CDD:214653 21/76 (28%)
Ig 147..219 CDD:299845 21/75 (28%)
I-set 224..323 CDD:254352 20/109 (18%)
IGc2 236..314 CDD:197706 19/84 (23%)
FN3 339..431 CDD:238020 21/134 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.