DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and DIP-theta

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:430 Identity:103/430 - (23%)
Similarity:176/430 - (40%) Gaps:67/430 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   620 EEARRDMQLNVNSPPVIEPFKFPKNLQE-----GGRAQITCAVSSGDMPIY-FSWKKDDSSIPSS 678
            |:.|.|..  ||:.|..:..||.:.||.     ...|.:.|.|.  ::..| .:|.:.|:....:
  Fly   113 EDIREDTV--VNAIPEKDLPKFGELLQNVTVPVSREAVLQCVVD--NLQTYKIAWLRVDTQTILT 173

  Fly   679 LQ-----------ITEKKEEFYSLLVFKDISARHSGKYTCYASNAAAK--VNYTAELQVRVAPRW 730
            :|           ||..::..: :|..:|:.....|.|.|..:....|  |.|   |.|.|.|..
  Fly   174 IQNHVITKNHRMSITHAEKRAW-ILRIRDVKESDKGWYMCQINTDPMKSQVGY---LDVVVPPDI 234

  Fly   731 RYEPMDTAIML--GNTISINCEAEGYPIPTITWFKGQGKGSKDFKPL-----SMRNHSLLLNLAT 788
            ...|..|.:::  |:.:::.|.|.|.|.|||||.:..|    :..||     ::..:...|.:|.
  Fly   235 LDYPTSTDMVIREGSNVTLKCAATGSPTPTITWRREGG----ELIPLPNGAEAVAYNGSFLTIAK 295

  Fly   789 DN--DEGYYMCQATNEIGAGLKKTIRINVNEPARFEQSARNISSRRNDPVTLDCHAKGDEPITIG 851
            .|  :.|.|:|.|:|.|...:.|.:.:.|:.|.......:.:.:.....:||:|.::. .|.:|.
  Fly   296 VNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEA-YPKSIN 359

  Fly   852 WTQNNGRIDLNNFRFSIAEMKTEKGVDSQLTIGHSDRHDSGVYRCIAENPYGRAEQIIFLAVQER 916
            :...|..|.:...||.....::...:..:|||...|..|.|.|||:|:|..|             
  Fly   360 YWMKNDTIIVPGERFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLG------------- 411

  Fly   917 PDTPSHLEIFEVGSRTVKLSWRRPFDGNSPVLSYLVQYQALKYLQSHGSLAAAGGDWNGHVINV- 980
             ||...::::.: .:|..::...|....:.|...||:|..   .|.:||  :...:.|.:..|. 
  Fly   412 -DTDGAIKLYHI-PQTTTMTTMAPTVSINTVPVVLVKYNK---EQRYGS--SQNSNTNPYNFNPG 469

  Fly   981 -SLPSTSISR----SYDSDLRESAIVAGLTPATTFLIRMQ 1015
             |..:|.:.|    |..||...|.:......||:.|...|
  Fly   470 NSQQNTKLQRGKSNSKGSDQSPSGLNNVFVGATSSLWNSQ 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352 23/108 (21%)
ig 645..712 CDD:278476 16/83 (19%)
IG_like 734..815 CDD:214653 25/89 (28%)
Ig 745..815 CDD:299845 22/76 (29%)
I-set 820..913 CDD:254352 21/92 (23%)
Ig 838..920 CDD:299845 21/81 (26%)
FN3 917..1033 CDD:238020 24/105 (23%)
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 20/98 (20%)
IG_like 137..230 CDD:214653 20/98 (20%)
IG_like 240..324 CDD:214653 24/87 (28%)
IGc2 247..310 CDD:197706 20/66 (30%)
Ig 327..419 CDD:299845 24/106 (23%)
IG_like 343..420 CDD:214653 23/91 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.