DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and fipi

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:505 Identity:113/505 - (22%)
Similarity:187/505 - (37%) Gaps:122/505 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   582 SNHYELASVADGGQLVIKNVEPGRDQGIYT---CIVRSRAGEEARRDMQLNVNSPPVIEPFKFPK 643
            :||:|..|::.....|::          ||   .||:.|:.:            |.|...:|.||
  Fly    19 ANHHESLSLSPAEHSVVR----------YTNESLIVQCRSPD------------PKVELHWKSPK 61

  Fly   644 N---LQEGGRAQITCAVSSGDMPIYFSWKKDDSSIPSSLQITEKKEEFYSLLVFKDISARHSGKY 705
            .   .:..||..|                 :.:|       ||:.:     :||..|:....|.:
  Fly    62 GEIIREHKGRIHI-----------------EQTS-------TEQLK-----IVFAHIALADKGNW 97

  Fly   706 TCYASNAA-----------AKVNYTAELQVRVAPRWRYEPMDTAIMLGNTISINCEAEGYPIPTI 759
            :|.|::.:           .|:.:|....|            ..:..|...:|.||.:|.|.|.:
  Fly    98 SCEAADGSLHSKSFDLIVYQKITFTENATV------------MTVKEGEKATILCEVKGEPQPNV 150

  Fly   760 TW-FKGQ--GKGSKDFKPLSMRNHSLLLNLATDNDEGYYMCQA--TNEIGAGL-KKTIRINVNEP 818
            || |.||  ..|:.|.....:....||:|..|.||.|.|.|:|  .|.|.:.: ::|:.:.:...
  Fly   151 TWHFNGQPISAGAADDSKFRILADGLLINKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHK 215

  Fly   819 ARFEQSARNISSRR---NDPVTLDCHAKGDEPITIGWTQNNGRIDLNNFRFSIAEMKTEKGVDSQ 880
            ..:.::. .:|.:.   |...||.|.|..:.|....|.:.:.::..||..::|    ......|.
  Fly   216 PIWSKTP-FVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTI----QSDSYWSS 275

  Fly   881 LTIGHSDRHDSGVYRCIAENPYGRAEQIIFLAVQERPDTPSHLEIFEVGSRT--VKLSW-RRPFD 942
            |||...:......|||.|.|..|..|:...|...|:|.:|::.::....|.|  |.||. |.|.|
  Fly   276 LTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRGPPD 340

  Fly   943 GNSPVLSYLVQYQALKYLQSHGSLAAAGGDWNGHVINVSLPSTSISRSYDSDLRESA--IVAGLT 1005
            ....|..:.::|      .:........|.|..            :|..|....|.|  ::..|.
  Fly   341 SPMGVNGFRIEY------MTEMEFKTDAGKWTN------------ARRKDYAFEEGATFLLTNLE 387

  Fly  1006 PATTFLIRMQAINEIERSAYTEAIVLKTQEEAP-----TEAPSNVQVQTG 1050
            |.|.:|:|..:.|....|.:|:....||....|     .:...|:.|:.|
  Fly   388 PDTVYLVRAASRNLAGFSDFTKVEKYKTLSLEPRVSSGVKETRNMCVELG 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706 10/39 (26%)
I-set 634..724 CDD:254352 18/103 (17%)
ig 645..712 CDD:278476 12/66 (18%)
IG_like 734..815 CDD:214653 27/86 (31%)
Ig 745..815 CDD:299845 26/75 (35%)
I-set 820..913 CDD:254352 23/95 (24%)
Ig 838..920 CDD:299845 22/81 (27%)
FN3 917..1033 CDD:238020 26/120 (22%)
FN3 1040..1142 CDD:238020 3/11 (27%)
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
fipiNP_787975.1 IG_like 33..115 CDD:214653 23/132 (17%)
I-set 128..202 CDD:254352 26/73 (36%)
Ig 133..>193 CDD:299845 23/59 (39%)
IG_like 228..307 CDD:214653 21/82 (26%)
Ig 235..305 CDD:143165 20/73 (27%)
FN3 312..415 CDD:238020 26/120 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.