DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and dpr2

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:295 Identity:69/295 - (23%)
Similarity:108/295 - (36%) Gaps:48/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   621 EARRDMQLNVNSPPVIEPFKFPKNL--QEGGRAQITCAVSS-GDMPIYFSW-KKDDSSIPSSLQI 681
            ||..........||.:..|..|:|:  :.|..|.|.|.|.: ||..:  || :|.|..|.::..:
  Fly    92 EAEEQPPEETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSV--SWIRKRDLHILTAGIL 154

  Fly   682 TEKKEEFYSL----------LVFKDISARHSGKYTCYASNAAAKVNYTAELQVRVAPRWRYE--- 733
            |...:|.:.:          |..|....|.||.|.|.. |...|::....|.|.|.|.....   
  Fly   155 TYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQV-NTEPKISMAFRLNVIVTPPDAKAIIA 218

  Fly   734 -PMDTAIMLGNTISINCEAE-----GYPIPTITWFKG----------QGKGSKDFKPLSMRN--- 779
             |.|..:.:|:::::.|..:     ...|..|.|::|          ....:.|.:.:||.:   
  Fly   219 GPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLA 283

  Fly   780 HSLLLNLATDN----DEGYYMCQATNEIGAGLKKTIRINVNEPARFEQS--ARNISSRRNDPVTL 838
            ..|...|...|    |.|.|.|..|....|.:...: ||...||..::|  .|...|.|:..:.|
  Fly   284 EKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNV-INDESPAAMQKSRAIRTSGSMRSSRLVL 347

  Fly   839 DCHAKGDEPITIGWTQNNGRIDLNNFRFSIAEMKT 873
            ........  .:.|.....||..|:...|.:.:.|
  Fly   348 LLAMVASS--VVRWLIGGQRIGSNSCHDSCSNLST 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352 28/103 (27%)
ig 645..712 CDD:278476 21/80 (26%)
IG_like 734..815 CDD:214653 21/102 (21%)
Ig 745..815 CDD:299845 18/91 (20%)
I-set 820..913 CDD:254352 11/56 (20%)
Ig 838..920 CDD:299845 7/36 (19%)
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 26/95 (27%)
Ig 116..192 CDD:299845 21/77 (27%)
ig 220..306 CDD:278476 17/85 (20%)
IG_like 220..306 CDD:214653 17/85 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.