DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and dpr3

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:387 Identity:85/387 - (21%)
Similarity:135/387 - (34%) Gaps:108/387 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 RPDDGGLYKCVASNSMGSVQHSARLNVYGPPYVRAIGPIKAVAGEDIIVHCPFAGYPVEQIRWEK 574
            :|||.|     ...::.:...|::.....||...|.....:          .|:.:.|       
  Fly   139 QPDDSG-----DGPTLSTFLSSSQSQSPSPPAASASASSPS----------SFSSFAV------- 181

  Fly   575 AHQELTTSNHYELASVADGGQLVIKNVEPGRDQGIYTCIVRSRAG--EEARRDMQLNVNSPPVIE 637
            ||...|.:.::...|:|      ..:...|.|....|...|.|:|  :|..:|...:.:.|  |.
  Fly   182 AHGPQTEATNHTFKSLA------FLDASFGSDLFAQTDAKRERSGAADEESQDADTSQSLP--IF 238

  Fly   638 PFKFPKNLQEGGR-----AQITCAVSS-GDMPIYFSW-KKDDSSI----------PSSLQITEKK 685
            .|..|:|:.  ||     |.|.|.|.| .|..:  || :|.|..|          ....|:||.|
  Fly   239 DFGMPRNIT--GRTGHTEAIIKCRVDSLHDKSV--SWIRKRDLHILTVGTATYTSDKRFQVTESK 299

  Fly   686 EEFYSLLVFKDISARHSGKYTCYASNAAAKVNYTAELQ-VRVAPRWR---YEPMDTAIMLGNTIS 746
            :.....|..|...|:.||.|.|.. |...|::...:|. :.::|..:   ..|.|.....|:.|.
  Fly   300 DSREWTLHVKAPLAKDSGIYECQV-NTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGSAII 363

  Fly   747 INC---EAEGYPIPTITWFKGQ-----------------GKGS------KDFKP----------- 774
            :||   :.....|..|.|::|:                 |:|.      :|..|           
  Fly   364 LNCLVQQPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQM 428

  Fly   775 -----LSMRNH-------SLLLNLATDNDEGYYMCQATNEIGAGLKKTIRINVNEPARFEQS 824
                 ::|.:.       .|.::.|...|.|.|.||.|....|.:...: ||...||..::|
  Fly   429 EFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHV-INDENPAAMQKS 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165 5/22 (23%)
IGc2 553..619 CDD:197706 12/65 (18%)
I-set 634..724 CDD:254352 31/107 (29%)
ig 645..712 CDD:278476 24/83 (29%)
IG_like 734..815 CDD:214653 25/129 (19%)
Ig 745..815 CDD:299845 22/118 (19%)
I-set 820..913 CDD:254352 1/5 (20%)
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
dpr3NP_001014459.2 Ig 243..330 CDD:299845 28/91 (31%)
IG_like 243..329 CDD:214653 27/90 (30%)
Ig 350..464 CDD:299845 20/113 (18%)
IG_like <441..477 CDD:214653 9/35 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.