DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and AgaP_AGAP010185

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:XP_554085.3 Gene:AgaP_AGAP010185 / 3292140 VectorBaseID:AGAP010185 Length:153 Species:Anopheles gambiae


Alignment Length:175 Identity:39/175 - (22%)
Similarity:62/175 - (35%) Gaps:53/175 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   596 LVIKNVEPGRDQGIYTCIVR-SRAGEEARRD-MQLNVNSPPVIEPFKFPKNLQ--EGGRAQITCA 656
            |.|.|....||.|.:.|.|: |..|.:..:: ..|.|.:||. .||..|..|:  |..:..:||:
Mosquito    12 LTIMNTSYSRDNGRFECRVKASGTGADVHQEYYNLTVLTPPQ-PPFVEPVELRATEDEKFDLTCS 75

  Fly   657 VSSGDMPIYFSWKKDDSSIP----------------SSLQITEKKEEFYSLLVFKDISARHSGKY 705
            ...|......:|.:..|..|                |:|.|..::|:             ...|:
Mosquito    76 SIGGSPDPTITWYRVGSEKPLKSTITKGGSKDLRTSSTLSIVPRRED-------------DGAKF 127

  Fly   706 TCYASNAAAKVNYTAELQVRVAPRWRYEPMDTAIMLGNTISINCE 750
            .|...|.|..               ..:.::|.:    |:|:|||
Mosquito   128 RCVVWNRAMS---------------EKDKLETTV----TLSVNCE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706 9/23 (39%)
I-set 634..724 CDD:254352 20/107 (19%)
ig 645..712 CDD:278476 14/84 (17%)
IG_like 734..815 CDD:214653 6/17 (35%)
Ig 745..815 CDD:299845 4/6 (67%)
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
AgaP_AGAP010185XP_554085.3 Ig 55..131 CDD:299845 17/88 (19%)
IG_like 59..150 CDD:214653 19/122 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.