DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Dscam3 and AgaP_AGAP009245

DIOPT Version :9

Sequence 1:	NP_996226.2	Gene:	Dscam3 / 42103	FlyBaseID:	FBgn0261046	Length:	2087	Species:	Drosophila melanogaster
Sequence 2:	XP_553184.3	Gene:	AgaP_AGAP009245 / 3291935	VectorBaseID:	AGAP009245	Length:	203	Species:	Anopheles gambiae

Alignment Length:	182	Identity:	38/182 - (20%)
Similarity:	58/182 - (31%)	Gaps:	67/182 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly   740 MLGNTISINCEAEGYPIPTITWFK---------GQGKGSKDFKPLSMRN-----HSLLLNLATDN 790
            ::|||..:||........|::|.:         |:...:.|.:..|:.|     .||.:......
Mosquito    53 LVGNTAYLNCRVRNLGNRTVSWIRHRDLHLLTVGKATYTSDQRYQSVHNPQLDDWSLKVLYPQQR 117

  Fly   791 DEGYYMCQ--ATNEIGAGLKKTIRINVNEPARFEQSARNISSRRNDPVTLDCHAKGDEPITIGWT 853
            |.|.|.||  .|..:|..:..::.||.:.|                        :|...:.
Mosquito   118 DSGVYECQISTTPPVGYSMTLSVEINYDSP------------------------RGGVSVI---- 154

  Fly   854 QNNGRIDLNNFRFSIAEMKTEKG--VDSQLTIGHSDRHDSGVYRCIAE--NP 901
                               ||||  ..|.|.|..:...|||.|.|:..  ||
Mosquito   155 -------------------TEKGDITTSYLLIQRARSTDSGKYTCLPSMANP 187

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Dscam3	NP_996226.2	IG	56..133	CDD:214652
		Ig	56..125	CDD:143165
		I-set	246..337	CDD:254352
		Ig	264..334	CDD:143165
		I-set	345..433	CDD:254352
		Ig	358..431	CDD:143165
		Ig	456..533	CDD:143165
		IGc2	553..619	CDD:197706
		I-set	634..724	CDD:254352
		ig	645..712	CDD:278476
		IG_like	734..815	CDD:214653	21/90 (23%)
		Ig	745..815	CDD:299845	18/85 (21%)
		I-set	820..913	CDD:254352	15/86 (17%)
		Ig	838..920	CDD:299845	15/68 (22%)
		FN3	917..1033	CDD:238020
		FN3	1040..1142	CDD:238020
		fn3	1150..1237	CDD:278470
		FN3	1263..1345	CDD:238020
		Ig	1350..1436	CDD:299845
		IG_like	1358..1436	CDD:214653
		FN3	1441..1530	CDD:238020
		FN3	1542..1620	CDD:238020
AgaP_AGAP009245	XP_553184.3	Ig	47..140	CDD:299845	20/86 (23%)
		IG_like	47..140	CDD:214653	20/86 (23%)
		IG_like	127..>180	CDD:214653	17/99 (17%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810