DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and dpr18

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:438 Identity:84/438 - (19%)
Similarity:131/438 - (29%) Gaps:185/438 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   609 IYTCIVRSRAGEEARRDMQLNVNSPPVIEPFKFPKNLQEGGRAQITCAVSSGDMP--IYFSWKKD 671
            |.|.:.|.:...|....|:.:.||.|:       ||:  |...|:|...    ||  .:.|.|.|
  Fly   125 IPTKMSRGKIPMETPGSMEFSSNSLPI-------KNV--GTTDQLTTVT----MPTTAFASLKVD 176

  Fly   672 DSSIPSSLQITEKKEEFYSLLVFKDISARHSGKYTCYASNAAAKVNYTAELQVRVA--PRWRY-- 732
            .|::...:..|..:.                              ::||....||.  ||.::  
  Fly   177 RSTMKQPIDSTRTRN------------------------------HWTASGFARVTERPRSKHHH 211

  Fly   733 ---------EPMDTAIMLGNTIS---------INCEAEGYPIPTITW-----------------F 762
                     ||:::|....|.:|         :||........|:.|                 :
  Fly   212 EHHWGPFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTY 276

  Fly   763 KGQGKGSKDFK-PLSMRNHSLLLNLATDNDEGYYMCQATNEIGAGLKKTIRINVNEPAR--FEQS 824
            .|..:....|: |   .|..||:|.....|.|.||||.:.......  |..:.|.||..  .::.
  Fly   277 SGDPRIRVKFQYP---NNWRLLINPTQTEDAGVYMCQVSTHPPRVF--TTNLTVLEPPLRIIDEH 336

  Fly   825 ARNISSR---RNDPVTLDCH--------------------------------------------- 841
            .|::..|   ....|.|.|.                                             
  Fly   337 ERDVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQ 401

  Fly   842 ------------------AKGDEPITIGWTQNNGRIDLNNFRFSIAEMKTEKGVDSQLTIGHSDR 888
                              ||.:||:.          .:.|.|.|::::    .:.|:::||.:..
  Fly   402 HKFSGQDLEKYFTKFITWAKDEEPLQ----------GMTNRRLSVSDV----WLTSRISIGDAKL 452

  Fly   889 HDSGVYRCIAENPYGRAEQIIFLAVQ----ERPDTPSHLEIFEVGSRT 932
            .|||.|.|    ..||...:| :.||    |.|....|    .:||||
  Fly   453 SDSGNYSC----SLGRLFTVI-VQVQVLTGELPAAVQH----NIGSRT 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706 3/9 (33%)
I-set 634..724 CDD:254352 15/91 (16%)
ig 645..712 CDD:278476 10/68 (15%)
IG_like 734..815 CDD:214653 22/107 (21%)
Ig 745..815 CDD:299845 19/96 (20%)
I-set 820..913 CDD:254352 23/160 (14%)
Ig 838..920 CDD:299845 24/148 (16%)
FN3 917..1033 CDD:238020 6/16 (38%)
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
dpr18NP_573102.1 IG_like 242..325 CDD:214653 18/87 (21%)
Ig <258..326 CDD:299845 15/72 (21%)
IGc2 <417..461 CDD:197706 15/61 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.